Clone IP19919 Report

Search the DGRC for IP19919

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:19
Vector:pOT2
Associated Gene/TranscriptCG12479-RA
Protein status:IP19919.pep: gold
Sequenced Size:444

Clone Sequence Records

IP19919.complete Sequence

444 bp assembled on 2011-03-09

GenBank Submission: BT126249.1

> IP19919.complete
GTAACATCTGGCAGCAAACAAAAAAAAAAAAACGAAAAAATTAATAACAA
ATTATCTATTAGCAGCTGGCACTGGAGATTACTAAATATGTCGACTACTC
CAGAGGATCGGCTGCGTGAGAACATCAATCGATGCCTCTCGGATTCCCTG
GTGAAGGGAGTTGGTGGTCTGGTGATCGGATCCGTGGTCACCCTGCTCTT
CTTCCGTAGGCGCATATGGCCCGTCTGGCTGGGCACTGGATTCGGCGTGG
GCGTGGCATATCGTGGCTGTGAAAAGGAGCTCAACGATGTAAAGTTTGGC
CAACGAAAGTGATCTTAAGCATTCGGACTTTGGATTTTACTGATGCTTAC
ACGTCTTTGATTACATGGCTTGCGTTTATTTGGATTGTGCAACGAATTGA
GTAAATAAACTCGAAGAAACAATAAAAAAAAAAAAAAAAAAAAA

IP19919.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14042163..14042586 423..1 2040 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14151568..14152002 434..1 2110 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14159666..14160100 434..1 2120 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:10 has no hits.

IP19919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:09 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14042163..14042586 1..423 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 10:03:15 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 1..225 88..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:44 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 1..225 88..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:08 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 1..225 88..312 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 10:03:14 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 5..428 1..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:44 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 5..428 1..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:08 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 5..428 1..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:09 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
X 14151579..14152002 1..423 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:09 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
X 14151579..14152002 1..423 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:09 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
X 14151579..14152002 1..423 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:44 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14045612..14046035 1..423 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:58 Download gff for IP19919.complete
Subject Subject Range Query Range Percent Splice Strand
X 14159677..14160100 1..423 99   Minus

IP19919.pep Sequence

Translation from 0 to 311

> IP19919.pep
VTSGSKQKKKNEKINNKLSISSWHWRLLNMSTTPEDRLRENINRCLSDSL
VKGVGGLVIGSVVTLLFFRRRIWPVWLGTGFGVGVAYRGCEKELNDVKFG
QRK*

IP19919.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19235-PA 74 GF19235-PA 1..74 30..103 338 82.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19471-PA 74 GG19471-PA 1..74 30..103 377 97.3 Plus
Dere\GG22938-PA 81 GG22938-PA 25..80 41..96 154 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17826-PA 73 GH17826-PA 10..73 35..98 157 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-PA 74 CG12479-PA 1..74 30..103 391 100 Plus
CG41128-PB 72 CG41128-PB 9..72 35..98 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 43..95 150 50.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21742-PA 73 GI21742-PA 10..73 35..98 153 54.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14995-PA 79 GL14995-PA 3..72 31..100 208 52.9 Plus
Dper\GL21878-PA 96 GL21878-PA 36..96 37..98 200 61.3 Plus
Dper\GL11664-PA 86 GL11664-PA 7..86 22..102 171 40.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22471-PA 79 GA22471-PA 3..73 31..101 208 52.1 Plus
Dpse\GA28225-PA 69 GA28225-PA 1..69 30..98 205 53.6 Plus
Dpse\GA25618-PA 96 GA25618-PA 36..96 37..98 204 61.3 Plus
Dpse\GA12365-PA 86 GA12365-PA 7..86 22..102 171 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17571-PA 74 GM17571-PA 1..74 30..103 383 100 Plus
Dsec\GM18303-PA 81 GM18303-PA 27..79 43..95 153 50.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15861-PA 74 GD15861-PA 1..74 30..103 383 100 Plus
Dsim\GD15460-PA 81 GD15460-PA 27..79 43..95 153 50.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19123-PA 73 GJ19123-PA 10..73 35..98 148 53.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18838-PA 75 GK18838-PA 8..75 31..98 221 52.9 Plus
Dwil\GK19385-PA 72 GK19385-PA 3..72 33..98 167 47.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16125-PA 74 GE16125-PA 1..74 30..103 377 97.3 Plus
Dyak\GE14376-PA 81 GE14376-PA 25..79 41..95 144 43.6 Plus

IP19919.hyp Sequence

Translation from 87 to 311

> IP19919.hyp
MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGT
GFGVGVAYRGCEKELNDVKFGQRK*

IP19919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-PA 74 CG12479-PA 1..74 1..74 391 100 Plus
CG41128-PB 72 CG41128-PB 9..72 6..69 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 14..66 150 50.9 Plus