Clone IP19930 Report

Search the DGRC for IP19930

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:30
Vector:pOT2
Associated Gene/TranscriptCG33704-RA
Protein status:IP19930.pep: gold
Sequenced Size:683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33704 2008-04-29 Release 5.5 accounting
CG33704 2008-05-05 Release 5.5 slip selected
CG33704 2008-08-15 Release 5.9 accounting
CG33704 2008-12-18 5.12 accounting

Clone Sequence Records

IP19930.complete Sequence

683 bp assembled on 2008-05-14

GenBank Submission: BT030928

> IP19930.complete
AACACTTTTCGTTTCGAGAGGAAAACAAATTCAAAACAGACTAAATTTCA
GGCACCTTCAGCATGGCGGACATGGAGGAATATAACCATCCATTGGCGAA
AATAACATCTATATCCGAGGAACTGGAACGAACTCATCTGGCCCGCGTGC
CGCAGGTCCTGCAGCGATTGGAGGACATCCGGGAGCCGGAGGATGAAATG
CTGCTGGCTGAAGGTAGTCGACTGAGCAAGAAACTCACTTGGGAGGACTA
CTAGGAATCAACGAAATTTTCACGTCACAAACGTAACGAGTGACACCTGC
CCGAGGTGCCAAGCTGCCAAGGAGACGGGGGGGGGGGGGGGAGAATCAAG
GTGTTGGCCCGGCAATTAATGACTCGGCTCGACTTTTCACATTCACATTC
ACATGCTCGAGCTGGGCAAACAATGCTGAGGGCGACAACAGGAGCACGCA
AGCCAAAAGGACTCGGGCTGAAAGGCACACAAATAAATTGTGACAAAGTT
GCGGAAATTTAATTAAAATCAAATAGAGGCGGCTAAGCGAAAAAGGGGTA
GCGAATTGGCAGTCAGGTGTGACCCGATATAGTTGGTAACACGCTTCCAA
CTTGCTACGAATATTGCTAGTTTTCCGCGTCGTTTAATAAACAAAATGTA
AACAATGTTTAACAGCAAAAAAAAAAAAAAAAA

IP19930.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-RA 945 CG33704-RA 159..828 1..668 3295 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16836989..16837531 126..666 2620 99.3 Plus
chr2R 21145070 chr2R 16836603..16836728 1..126 615 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20950552..20951096 126..668 2660 99.6 Plus
2R 25286936 2R 20950157..20950282 1..126 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20951751..20952295 126..668 2670 99.6 Plus
2R 25260384 2R 20951356..20951481 1..126 630 100 Plus
Blast to na_te.dros performed 2019-03-16 09:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 757..801 295..250 110 73.9 Minus

IP19930.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:39:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16836603..16836728 1..126 99 -> Plus
chr2R 16836990..16837531 127..666 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:04 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 1..192 63..254 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:11 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 1..192 63..254 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:03:39 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 1..192 63..254 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:23 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 1..192 63..254 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 1..192 63..254 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:06 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 56..712 1..655 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:11 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 56..723 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:03:39 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 56..723 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:24 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 56..712 1..655 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 56..723 1..666 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20950157..20950282 1..126 100 -> Plus
2R 20950553..20951094 127..666 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20950157..20950282 1..126 100 -> Plus
2R 20950553..20951094 127..666 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:50 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20950157..20950282 1..126 100 -> Plus
2R 20950553..20951094 127..666 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:03:39 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16837662..16837787 1..126 100 -> Plus
arm_2R 16838058..16838599 127..666 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:11 Download gff for IP19930.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20951356..20951481 1..126 100 -> Plus
2R 20951752..20952293 127..666 99   Plus

IP19930.pep Sequence

Translation from 62 to 253

> IP19930.pep
MADMEEYNHPLAKITSISEELERTHLARVPQVLQRLEDIREPEDEMLLAE
GSRLSKKLTWEDY*

IP19930.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12209-PA 62 GF12209-PA 1..57 1..57 173 64.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22069-PA 63 GG22069-PA 1..63 1..63 300 93.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-PA 63 CG33704-PA 1..63 1..63 321 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17062-PA 63 GL17062-PA 5..58 4..57 139 57.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24347-PA 63 GA24347-PA 5..58 4..57 138 57.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15788-PA 63 GM15788-PA 1..63 1..63 316 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11549-PA 63 GD11549-PA 1..63 1..63 316 98.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12150-PA 63 GE12150-PA 1..63 1..63 314 98.4 Plus

IP19930.hyp Sequence

Translation from 62 to 253

> IP19930.hyp
MADMEEYNHPLAKITSISEELERTHLARVPQVLQRLEDIREPEDEMLLAE
GSRLSKKLTWEDY*

IP19930.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-PA 63 CG33704-PA 1..63 1..63 321 100 Plus