Clone IP19941 Report

Search the DGRC for IP19941

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:41
Vector:pOT2
Associated Gene/TranscriptCG31788-RA
Protein status:IP19941.pep: gold
Sequenced Size:362

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31788 2008-04-29 Release 5.5 accounting
CG31788 2008-05-05 Release 5.5 slip selected
CG31788 2008-08-15 Release 5.9 accounting
CG31788 2008-12-18 5.12 accounting

Clone Sequence Records

IP19941.complete Sequence

362 bp assembled on 2008-05-14

GenBank Submission: BT030933

> IP19941.complete
TCTCGACAAGGAAACATCTAAACTTCCATTTTTATTTTACTTTTACAAAA
TAACATCATAATGTTTGAGTCTTTCGATTGGACCTTGGGATTAGATTTGA
AGAACTTTCGCGATGTGAAACAGCGTGTAGTAAGAAAAATCGGGGAACTG
GAGCAACATGGAGCCAAGTGGGGTCGCCTCATCGGCATCGAAGATGGCAA
GGATGATGCTTTCATTCGTTTCATGAAGCAGAACATTTAGCAAAGTTAAC
AAAATTGGAAAATGGCGTATTGCATGTTACCTTAAAGCCTGACAAGAATA
CACATGTTCAATATAAAAAATGCATTACTTTGCGTAAACAATTTGAAAAA
AAAAAAAAAAAA

IP19941.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-RA 429 CG31788-RA 81..426 1..346 1730 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18256166..18256445 345..66 1400 100 Minus
chr2L 23010047 chr2L 18256506..18256570 65..1 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18257493..18257773 346..66 1405 100 Minus
2L 23513712 2L 18257834..18257898 65..1 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18257493..18257773 346..66 1405 100 Minus
2L 23513712 2L 18257834..18257898 65..1 325 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:14:18 has no hits.

IP19941.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:15:18 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18256166..18256445 66..345 100 <- Minus
chr2L 18256506..18256570 1..65 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:15 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..180 61..240 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:20 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..180 61..240 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:32:30 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..180 61..240 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:12:52 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..180 61..240 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:16 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..180 61..240 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:25 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..339 7..345 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:19 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 5..349 1..345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:30 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 5..349 1..345 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:12:53 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 1..339 7..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:16 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 5..349 1..345 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18257494..18257773 66..345 100 <- Minus
2L 18257834..18257898 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18257494..18257773 66..345 100 <- Minus
2L 18257834..18257898 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18257494..18257773 66..345 100 <- Minus
2L 18257834..18257898 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:30 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18257494..18257773 66..345 100 <- Minus
arm_2L 18257834..18257898 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:03 Download gff for IP19941.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18257494..18257773 66..345 100 <- Minus
2L 18257834..18257898 1..65 100   Minus

IP19941.hyp Sequence

Translation from 60 to 239

> IP19941.hyp
MFESFDWTLGLDLKNFRDVKQRVVRKIGELEQHGAKWGRLIGIEDGKDDA
FIRFMKQNI*

IP19941.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-PB 59 CG31788-PB 1..59 1..59 313 100 Plus
CG31788-PA 59 CG31788-PA 1..59 1..59 313 100 Plus

IP19941.pep Sequence

Translation from 60 to 239

> IP19941.pep
MFESFDWTLGLDLKNFRDVKQRVVRKIGELEQHGAKWGRLIGIEDGKDDA
FIRFMKQNI*

IP19941.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21712-PA 57 GG21712-PA 1..57 3..59 261 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-PB 59 CG31788-PB 1..59 1..59 313 100 Plus
CG31788-PA 59 CG31788-PA 1..59 1..59 313 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17093-PA 83 GM17093-PA 27..83 3..59 282 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21837-PA 83 GD21837-PA 27..83 3..59 282 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12736-PA 68 GE12736-PA 18..68 9..59 219 82.4 Plus