IP19941.complete Sequence
362 bp assembled on 2008-05-14
GenBank Submission: BT030933
> IP19941.complete
TCTCGACAAGGAAACATCTAAACTTCCATTTTTATTTTACTTTTACAAAA
TAACATCATAATGTTTGAGTCTTTCGATTGGACCTTGGGATTAGATTTGA
AGAACTTTCGCGATGTGAAACAGCGTGTAGTAAGAAAAATCGGGGAACTG
GAGCAACATGGAGCCAAGTGGGGTCGCCTCATCGGCATCGAAGATGGCAA
GGATGATGCTTTCATTCGTTTCATGAAGCAGAACATTTAGCAAAGTTAAC
AAAATTGGAAAATGGCGTATTGCATGTTACCTTAAAGCCTGACAAGAATA
CACATGTTCAATATAAAAAATGCATTACTTTGCGTAAACAATTTGAAAAA
AAAAAAAAAAAA
IP19941.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:05:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31788-RA | 429 | CG31788-RA | 81..426 | 1..346 | 1730 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:14:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 18256166..18256445 | 345..66 | 1400 | 100 | Minus |
chr2L | 23010047 | chr2L | 18256506..18256570 | 65..1 | 325 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:14:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18257493..18257773 | 346..66 | 1405 | 100 | Minus |
2L | 23513712 | 2L | 18257834..18257898 | 65..1 | 325 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18257493..18257773 | 346..66 | 1405 | 100 | Minus |
2L | 23513712 | 2L | 18257834..18257898 | 65..1 | 325 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 06:14:18 has no hits.
IP19941.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:15:18 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 18256166..18256445 | 66..345 | 100 | <- | Minus |
chr2L | 18256506..18256570 | 1..65 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:15 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..180 | 61..240 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:20 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..180 | 61..240 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:32:30 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..180 | 61..240 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:12:52 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..180 | 61..240 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:16 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..180 | 61..240 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:25 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..339 | 7..345 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:19 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 5..349 | 1..345 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:30 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 5..349 | 1..345 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:12:53 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 1..339 | 7..345 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:16 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31788-RA | 5..349 | 1..345 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18257494..18257773 | 66..345 | 100 | <- | Minus |
2L | 18257834..18257898 | 1..65 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18257494..18257773 | 66..345 | 100 | <- | Minus |
2L | 18257834..18257898 | 1..65 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:18 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18257494..18257773 | 66..345 | 100 | <- | Minus |
2L | 18257834..18257898 | 1..65 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:30 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18257494..18257773 | 66..345 | 100 | <- | Minus |
arm_2L | 18257834..18257898 | 1..65 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:03 Download gff for
IP19941.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18257494..18257773 | 66..345 | 100 | <- | Minus |
2L | 18257834..18257898 | 1..65 | 100 | | Minus |
IP19941.hyp Sequence
Translation from 60 to 239
> IP19941.hyp
MFESFDWTLGLDLKNFRDVKQRVVRKIGELEQHGAKWGRLIGIEDGKDDA
FIRFMKQNI*
IP19941.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:00:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31788-PB | 59 | CG31788-PB | 1..59 | 1..59 | 313 | 100 | Plus |
CG31788-PA | 59 | CG31788-PA | 1..59 | 1..59 | 313 | 100 | Plus |
IP19941.pep Sequence
Translation from 60 to 239
> IP19941.pep
MFESFDWTLGLDLKNFRDVKQRVVRKIGELEQHGAKWGRLIGIEDGKDDA
FIRFMKQNI*
IP19941.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:22:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21712-PA | 57 | GG21712-PA | 1..57 | 3..59 | 261 | 87.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31788-PB | 59 | CG31788-PB | 1..59 | 1..59 | 313 | 100 | Plus |
CG31788-PA | 59 | CG31788-PA | 1..59 | 1..59 | 313 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:22:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17093-PA | 83 | GM17093-PA | 27..83 | 3..59 | 282 | 94.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:22:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21837-PA | 83 | GD21837-PA | 27..83 | 3..59 | 282 | 94.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:22:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12736-PA | 68 | GE12736-PA | 18..68 | 9..59 | 219 | 82.4 | Plus |