Clone IP19960 Report

Search the DGRC for IP19960

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:60
Vector:pOT2
Associated Gene/TranscriptVkor-RA
Protein status:IP19960.pep: Imported from assembly
Sequenced Size:534

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Vkor 2008-04-29 Release 5.5 accounting
Vkor 2008-05-05 Release 5.5 slip selected
Vkor 2008-08-15 Release 5.9 accounting
Vkor 2008-12-18 5.12 accounting

Clone Sequence Records

IP19960.complete Sequence

534 bp assembled on 2008-05-14

GenBank Submission: BT030938

> IP19960.complete
CAGGCGTACAGTACAGCTTCCCGACTGCGTGGGATTTGCGTTTGTGGATT
GGCCATTTCGGTGTATTCACTGTATGTGAAAATGAAACTAAAGGAGGATG
AGAACTATAGGCCAATGTGCGACGTTAACGATAATATAAGCTGCTCGCTG
GTTTTTAAATCGGGCTATGGTGATGGCTTTGGTCTGGGTAACATAACCCA
AGTAAATGCTCCCAACGGAGCCATCGGCTGTGCATTTTATATCCTGTACT
TCTTGAGCTCTTTCTTTAATCATCGTTGGCTGTGCCTGGTCCAATTGATA
GTATGCACTTTGACATTACTTCTCTGCGTTTATCTGGGTTTCCTGCTGAT
TCTCGTGTTTTACGATTTCTGTTTGGTATGCGTGACCATCTATTTCATAC
ACACATGGCTCTTTCAGGAAGTCCTAAGGCGATATAGACGCCTTTATATG
TAAGATTTGTACAATGTTAAGACAAGCTAAGCAAAAATTATGAAGATAAA
TCCCTAAGATTAGTAAAAAAAAAAAAAAAAAAAA

IP19960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Vkor-RA 719 Vkor-RA 179..693 1..515 2575 100 Plus
Vkor.b 894 Vkor.b 179..693 1..515 2575 100 Plus
Vkor.a 1453 Vkor.a 179..693 1..515 2575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12665951..12666205 260..514 1230 98.8 Plus
chr2R 21145070 chr2R 12665585..12665748 1..164 820 100 Plus
chr2R 21145070 chr2R 12665802..12665895 166..259 455 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16778740..16778995 260..515 1280 100 Plus
2R 25286936 2R 16778371..16778534 1..164 820 100 Plus
2R 25286936 2R 16778589..16778684 164..259 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16779939..16780194 260..515 1280 100 Plus
2R 25260384 2R 16779570..16779733 1..164 820 100 Plus
2R 25260384 2R 16779788..16779883 164..259 480 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:12:57 has no hits.

IP19960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:38 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12665801..12665895 165..259 97 -> Plus
chr2R 12665585..12665748 1..164 100 -> Plus
chr2R 12665951..12666205 260..514 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:25 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:49 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:49:08 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:50:02 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:51 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:34 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:48 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..520 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:49:08 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..520 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:50:02 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..459 1..453 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:51 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
Vkor-RA 7..520 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:38 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16778740..16778994 260..514 100   Plus
2R 16778371..16778534 1..164 100 -> Plus
2R 16778590..16778684 165..259 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:38 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16778740..16778994 260..514 100   Plus
2R 16778371..16778534 1..164 100 -> Plus
2R 16778590..16778684 165..259 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:38 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16778740..16778994 260..514 100   Plus
2R 16778371..16778534 1..164 100 -> Plus
2R 16778590..16778684 165..259 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:49:08 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12665876..12666039 1..164 100 -> Plus
arm_2R 12666095..12666189 165..259 100 -> Plus
arm_2R 12666245..12666499 260..514 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:14 Download gff for IP19960.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16779570..16779733 1..164 100 -> Plus
2R 16779789..16779883 165..259 100 -> Plus
2R 16779939..16780193 260..514 100   Plus

IP19960.pep Sequence

Translation from 0 to 452

> IP19960.pep
QAYSTASRLRGICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSL
VFKSGYGDGFGLGNITQVNAPNGAIGCAFYILYFLSSFFNHRWLCLVQLI
VCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTWLFQEVLRRYRRLYM
*

IP19960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11407-PA 161 GF11407-PA 3..159 1..150 541 65.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20627-PA 152 GG20627-PA 3..152 1..150 678 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23561-PA 173 GH23561-PA 27..163 19..149 292 55.5 Plus
Dgri\GH23087-PA 173 GH23087-PA 27..163 19..149 287 55.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Vkor-PA 152 CG33544-PA 3..152 1..150 808 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21152-PA 176 GI21152-PA 16..170 2..150 357 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11799-PA 171 GL11799-PA 6..162 1..150 421 58 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24080-PA 171 GA24080-PA 6..162 1..150 421 58 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21721-PA 152 GM21721-PA 3..152 1..150 672 92.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11216-PA 152 GD11216-PA 3..152 1..150 669 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21000-PA 176 GJ21000-PA 15..169 1..149 334 56.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19102-PA 165 GK19102-PA 7..159 4..150 398 54.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11817-PA 152 GE11817-PA 3..152 1..150 662 92 Plus

IP19960.hyp Sequence

Translation from 0 to 452

> IP19960.hyp
QAYSTASRLRGICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSL
VFKSGYGDGFGLGNITQVNAPNGAIGCAFYILYFLSSFFNHRWLCLVQLI
VCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTWLFQEVLRRYRRLYM
*

IP19960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Vkor-PA 152 CG33544-PA 3..152 1..150 808 100 Plus