BDGP Sequence Production Resources |
Search the DGRC for IP19960
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 199 |
Well: | 60 |
Vector: | pOT2 |
Associated Gene/Transcript | Vkor-RA |
Protein status: | IP19960.pep: Imported from assembly |
Sequenced Size: | 534 |
Gene | Date | Evidence |
---|---|---|
Vkor | 2008-04-29 | Release 5.5 accounting |
Vkor | 2008-05-05 | Release 5.5 slip selected |
Vkor | 2008-08-15 | Release 5.9 accounting |
Vkor | 2008-12-18 | 5.12 accounting |
534 bp assembled on 2008-05-14
GenBank Submission: BT030938
> IP19960.complete CAGGCGTACAGTACAGCTTCCCGACTGCGTGGGATTTGCGTTTGTGGATT GGCCATTTCGGTGTATTCACTGTATGTGAAAATGAAACTAAAGGAGGATG AGAACTATAGGCCAATGTGCGACGTTAACGATAATATAAGCTGCTCGCTG GTTTTTAAATCGGGCTATGGTGATGGCTTTGGTCTGGGTAACATAACCCA AGTAAATGCTCCCAACGGAGCCATCGGCTGTGCATTTTATATCCTGTACT TCTTGAGCTCTTTCTTTAATCATCGTTGGCTGTGCCTGGTCCAATTGATA GTATGCACTTTGACATTACTTCTCTGCGTTTATCTGGGTTTCCTGCTGAT TCTCGTGTTTTACGATTTCTGTTTGGTATGCGTGACCATCTATTTCATAC ACACATGGCTCTTTCAGGAAGTCCTAAGGCGATATAGACGCCTTTATATG TAAGATTTGTACAATGTTAAGACAAGCTAAGCAAAAATTATGAAGATAAA TCCCTAAGATTAGTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12665951..12666205 | 260..514 | 1230 | 98.8 | Plus |
chr2R | 21145070 | chr2R | 12665585..12665748 | 1..164 | 820 | 100 | Plus |
chr2R | 21145070 | chr2R | 12665802..12665895 | 166..259 | 455 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16778740..16778995 | 260..515 | 1280 | 100 | Plus |
2R | 25286936 | 2R | 16778371..16778534 | 1..164 | 820 | 100 | Plus |
2R | 25286936 | 2R | 16778589..16778684 | 164..259 | 480 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16779939..16780194 | 260..515 | 1280 | 100 | Plus |
2R | 25260384 | 2R | 16779570..16779733 | 1..164 | 820 | 100 | Plus |
2R | 25260384 | 2R | 16779788..16779883 | 164..259 | 480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12665801..12665895 | 165..259 | 97 | -> | Plus |
chr2R | 12665585..12665748 | 1..164 | 100 | -> | Plus |
chr2R | 12665951..12666205 | 260..514 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..520 | 1..514 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..520 | 1..514 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..459 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vkor-RA | 7..520 | 1..514 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16778740..16778994 | 260..514 | 100 | Plus | |
2R | 16778371..16778534 | 1..164 | 100 | -> | Plus |
2R | 16778590..16778684 | 165..259 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16778740..16778994 | 260..514 | 100 | Plus | |
2R | 16778371..16778534 | 1..164 | 100 | -> | Plus |
2R | 16778590..16778684 | 165..259 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16778740..16778994 | 260..514 | 100 | Plus | |
2R | 16778371..16778534 | 1..164 | 100 | -> | Plus |
2R | 16778590..16778684 | 165..259 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12665876..12666039 | 1..164 | 100 | -> | Plus |
arm_2R | 12666095..12666189 | 165..259 | 100 | -> | Plus |
arm_2R | 12666245..12666499 | 260..514 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16779570..16779733 | 1..164 | 100 | -> | Plus |
2R | 16779789..16779883 | 165..259 | 100 | -> | Plus |
2R | 16779939..16780193 | 260..514 | 100 | Plus |
Translation from 0 to 452
> IP19960.pep QAYSTASRLRGICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSL VFKSGYGDGFGLGNITQVNAPNGAIGCAFYILYFLSSFFNHRWLCLVQLI VCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTWLFQEVLRRYRRLYM *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11407-PA | 161 | GF11407-PA | 3..159 | 1..150 | 541 | 65.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20627-PA | 152 | GG20627-PA | 3..152 | 1..150 | 678 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23561-PA | 173 | GH23561-PA | 27..163 | 19..149 | 292 | 55.5 | Plus |
Dgri\GH23087-PA | 173 | GH23087-PA | 27..163 | 19..149 | 287 | 55.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vkor-PA | 152 | CG33544-PA | 3..152 | 1..150 | 808 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21152-PA | 176 | GI21152-PA | 16..170 | 2..150 | 357 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11799-PA | 171 | GL11799-PA | 6..162 | 1..150 | 421 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24080-PA | 171 | GA24080-PA | 6..162 | 1..150 | 421 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21721-PA | 152 | GM21721-PA | 3..152 | 1..150 | 672 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11216-PA | 152 | GD11216-PA | 3..152 | 1..150 | 669 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21000-PA | 176 | GJ21000-PA | 15..169 | 1..149 | 334 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19102-PA | 165 | GK19102-PA | 7..159 | 4..150 | 398 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11817-PA | 152 | GE11817-PA | 3..152 | 1..150 | 662 | 92 | Plus |
Translation from 0 to 452
> IP19960.hyp QAYSTASRLRGICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSL VFKSGYGDGFGLGNITQVNAPNGAIGCAFYILYFLSSFFNHRWLCLVQLI VCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTWLFQEVLRRYRRLYM *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vkor-PA | 152 | CG33544-PA | 3..152 | 1..150 | 808 | 100 | Plus |