Clone IP19977 Report

Search the DGRC for IP19977

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:77
Vector:pOT2
Associated Gene/Transcriptpen-2-RA
Protein status:IP19977.pep: gold
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pen-2 2008-04-29 Release 5.5 accounting
pen-2 2008-05-05 Release 5.5 slip selected
pen-2 2008-08-15 Release 5.9 accounting
pen-2 2008-12-18 5.12 accounting

Clone Sequence Records

IP19977.complete Sequence

561 bp assembled on 2008-05-14

GenBank Submission: BT030940

> IP19977.complete
CGCTCCAATGGACTAAAAACTAAAACACAAATCAACAAAAGCAAAAATTG
AAGTGAAAATATAAGCTATTACAATTTACATATTACATACAATTTACATA
TAAGTACGAAAAAACTTTCCTGGGCCGGAAACAGATTCGAAAACAAAGGA
GCAAACACCCACATATTTGAAGAGGATTAATCATGGACATCTCAAAGGCA
CCAAATCCGCGAAAACTGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTT
TGCATTTCTGCCCTTTGTGTGGGCCATTAACGTTTGCTGGTTTTTCACGG
AGGCCTTCCATAAGCCACCATTTTCGGAGCAGAGCCAAATAAAGAGATAT
GTTATATACTCTGCAGTGGGGACTCTATTCTGGCTGATAGTACTAACTGC
CTGGATAATAATATTCCAGACAAATCGCACAGCCTGGGGCGCCACAGCGG
ACTATATGAGCTTCATCATACCCCTAGGCAGTGCATAGACATAACTAGAT
TAATTCGTTAGCAACTAATGATATTAAAAAAGACTTCATTCCTAAAAAAA
AAAAAAAAAAA

IP19977.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-RA 752 pen-2-RA 62..612 1..551 2740 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14164524..14164766 1..243 1185 99.2 Plus
chr2R 21145070 chr2R 14165015..14165209 349..543 885 96.9 Plus
chr2R 21145070 chr2R 14164831..14164940 239..348 535 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18277439..18277681 1..243 1215 100 Plus
2R 25286936 2R 18277930..18278132 349..551 1000 99.5 Plus
2R 25286936 2R 18277746..18277855 239..348 535 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18278638..18278880 1..243 1215 100 Plus
2R 25260384 2R 18279129..18279331 349..551 1000 99.5 Plus
2R 25260384 2R 18278945..18279054 239..348 535 99 Plus
Blast to na_te.dros performed on 2019-03-16 06:12:48 has no hits.

IP19977.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:13:35 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14164524..14164766 1..243 99 -> Plus
chr2R 14164836..14164940 244..348 100 -> Plus
chr2R 14165015..14165209 349..543 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:31 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..306 183..488 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:51:00 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..306 183..488 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:32:09 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..306 183..488 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:50:13 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..306 183..488 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:14:45 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..306 183..488 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:14:00 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..456 88..543 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:51:00 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..456 88..543 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:09 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:50:13 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..456 88..543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:14:45 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 1..543 1..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:35 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18277439..18277681 1..243 100 -> Plus
2R 18277751..18277855 244..348 100 -> Plus
2R 18277930..18278124 349..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:35 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18277439..18277681 1..243 100 -> Plus
2R 18277751..18277855 244..348 100 -> Plus
2R 18277930..18278124 349..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:35 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18277439..18277681 1..243 100 -> Plus
2R 18277751..18277855 244..348 100 -> Plus
2R 18277930..18278124 349..543 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:09 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14164944..14165186 1..243 100 -> Plus
arm_2R 14165256..14165360 244..348 100 -> Plus
arm_2R 14165435..14165629 349..543 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:22 Download gff for IP19977.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18278638..18278880 1..243 100 -> Plus
2R 18278950..18279054 244..348 100 -> Plus
2R 18279129..18279323 349..543 100   Plus

IP19977.pep Sequence

Translation from 182 to 487

> IP19977.pep
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
A*

IP19977.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12150-PA 101 GF12150-PA 1..101 1..101 481 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21865-PA 101 GG21865-PA 1..101 1..101 527 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21656-PA 101 GH21656-PA 1..101 1..101 449 82.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-PB 101 CG33198-PB 1..101 1..101 548 100 Plus
pen-2-PA 101 CG33198-PA 1..101 1..101 548 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20110-PA 101 GI20110-PA 1..99 1..99 433 77.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17758-PA 101 GL17758-PA 1..101 1..101 458 84.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24901-PA 101 GA24901-PA 1..101 1..101 458 84.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21859-PA 101 GM21859-PA 1..101 1..101 517 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11355-PA 101 GD11355-PA 1..101 1..101 530 100 Plus
Dsim\GD15440-PA 101 GD15440-PA 1..101 1..101 527 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19879-PA 101 GJ19879-PA 1..101 1..101 452 82.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22972-PA 101 GK22972-PA 1..101 1..101 451 83.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11942-PA 101 GE11942-PA 1..101 1..101 530 100 Plus

IP19977.hyp Sequence

Translation from 182 to 487

> IP19977.hyp
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
A*

IP19977.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-PB 101 CG33198-PB 1..101 1..101 548 100 Plus
pen-2-PA 101 CG33198-PA 1..101 1..101 548 100 Plus