BDGP Sequence Production Resources |
Search the DGRC for IP19977
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 199 |
Well: | 77 |
Vector: | pOT2 |
Associated Gene/Transcript | pen-2-RA |
Protein status: | IP19977.pep: gold |
Sequenced Size: | 561 |
Gene | Date | Evidence |
---|---|---|
pen-2 | 2008-04-29 | Release 5.5 accounting |
pen-2 | 2008-05-05 | Release 5.5 slip selected |
pen-2 | 2008-08-15 | Release 5.9 accounting |
pen-2 | 2008-12-18 | 5.12 accounting |
561 bp assembled on 2008-05-14
GenBank Submission: BT030940
> IP19977.complete CGCTCCAATGGACTAAAAACTAAAACACAAATCAACAAAAGCAAAAATTG AAGTGAAAATATAAGCTATTACAATTTACATATTACATACAATTTACATA TAAGTACGAAAAAACTTTCCTGGGCCGGAAACAGATTCGAAAACAAAGGA GCAAACACCCACATATTTGAAGAGGATTAATCATGGACATCTCAAAGGCA CCAAATCCGCGAAAACTGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTT TGCATTTCTGCCCTTTGTGTGGGCCATTAACGTTTGCTGGTTTTTCACGG AGGCCTTCCATAAGCCACCATTTTCGGAGCAGAGCCAAATAAAGAGATAT GTTATATACTCTGCAGTGGGGACTCTATTCTGGCTGATAGTACTAACTGC CTGGATAATAATATTCCAGACAAATCGCACAGCCTGGGGCGCCACAGCGG ACTATATGAGCTTCATCATACCCCTAGGCAGTGCATAGACATAACTAGAT TAATTCGTTAGCAACTAATGATATTAAAAAAGACTTCATTCCTAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pen-2-RA | 752 | pen-2-RA | 62..612 | 1..551 | 2740 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14164524..14164766 | 1..243 | 1185 | 99.2 | Plus |
chr2R | 21145070 | chr2R | 14165015..14165209 | 349..543 | 885 | 96.9 | Plus |
chr2R | 21145070 | chr2R | 14164831..14164940 | 239..348 | 535 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18277439..18277681 | 1..243 | 1215 | 100 | Plus |
2R | 25286936 | 2R | 18277930..18278132 | 349..551 | 1000 | 99.5 | Plus |
2R | 25286936 | 2R | 18277746..18277855 | 239..348 | 535 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18278638..18278880 | 1..243 | 1215 | 100 | Plus |
2R | 25260384 | 2R | 18279129..18279331 | 349..551 | 1000 | 99.5 | Plus |
2R | 25260384 | 2R | 18278945..18279054 | 239..348 | 535 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14164524..14164766 | 1..243 | 99 | -> | Plus |
chr2R | 14164836..14164940 | 244..348 | 100 | -> | Plus |
chr2R | 14165015..14165209 | 349..543 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..306 | 183..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..306 | 183..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..306 | 183..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..306 | 183..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..306 | 183..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..456 | 88..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..456 | 88..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..456 | 88..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pen-2-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18277439..18277681 | 1..243 | 100 | -> | Plus |
2R | 18277751..18277855 | 244..348 | 100 | -> | Plus |
2R | 18277930..18278124 | 349..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18277439..18277681 | 1..243 | 100 | -> | Plus |
2R | 18277751..18277855 | 244..348 | 100 | -> | Plus |
2R | 18277930..18278124 | 349..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18277439..18277681 | 1..243 | 100 | -> | Plus |
2R | 18277751..18277855 | 244..348 | 100 | -> | Plus |
2R | 18277930..18278124 | 349..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14164944..14165186 | 1..243 | 100 | -> | Plus |
arm_2R | 14165256..14165360 | 244..348 | 100 | -> | Plus |
arm_2R | 14165435..14165629 | 349..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18278638..18278880 | 1..243 | 100 | -> | Plus |
2R | 18278950..18279054 | 244..348 | 100 | -> | Plus |
2R | 18279129..18279323 | 349..543 | 100 | Plus |
Translation from 182 to 487
> IP19977.pep MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS A*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12150-PA | 101 | GF12150-PA | 1..101 | 1..101 | 481 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21865-PA | 101 | GG21865-PA | 1..101 | 1..101 | 527 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21656-PA | 101 | GH21656-PA | 1..101 | 1..101 | 449 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pen-2-PB | 101 | CG33198-PB | 1..101 | 1..101 | 548 | 100 | Plus |
pen-2-PA | 101 | CG33198-PA | 1..101 | 1..101 | 548 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20110-PA | 101 | GI20110-PA | 1..99 | 1..99 | 433 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17758-PA | 101 | GL17758-PA | 1..101 | 1..101 | 458 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24901-PA | 101 | GA24901-PA | 1..101 | 1..101 | 458 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21859-PA | 101 | GM21859-PA | 1..101 | 1..101 | 517 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11355-PA | 101 | GD11355-PA | 1..101 | 1..101 | 530 | 100 | Plus |
Dsim\GD15440-PA | 101 | GD15440-PA | 1..101 | 1..101 | 527 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19879-PA | 101 | GJ19879-PA | 1..101 | 1..101 | 452 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22972-PA | 101 | GK22972-PA | 1..101 | 1..101 | 451 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11942-PA | 101 | GE11942-PA | 1..101 | 1..101 | 530 | 100 | Plus |
Translation from 182 to 487
> IP19977.hyp MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS A*