Clone IP19992 Report

Search the DGRC for IP19992

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:199
Well:92
Vector:pOT2
Associated Gene/TranscriptmRpL28-RA
Protein status:IP19992.pep: gold
Sequenced Size:1139

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL28 2008-04-29 Release 5.5 accounting
mRpL28 2008-08-15 Release 5.9 accounting
mRpL28 2008-12-18 5.12 accounting

Clone Sequence Records

IP19992.complete Sequence

1139 bp assembled on 2007-07-19

GenBank Submission: BT030944

> IP19992.complete
CCGTTGGCCTAGCCAAAATCAGGGAAAATATAGTTTAATAGCCAAGTTTA
AACTGCCACTATAGTTTTAATAGTGAATAATAACAGTAAACTGCTAGTTC
GTTCCTTAAAAAATGGCACACGCCACGCCACAGGGCGTAAAGCTATTAAA
CGGATGGAAGCGTCCGGGTCGCTTTGACAAGGGTCTGGGAGCCCAGCTGC
CCGAGGCGTACAGGAAGTTCTGGCGCGAGTGGAAGCTGACGACCCCGGCT
GCGGTCCATTATATCCCCAAGGAGCAGCAGTGGGAACGAGATGAGGTGAC
GCACGCCATCAAGCCGGTGCAGAACATCCCGCTGCCATTGATCGATACGC
CGGAATCGCACCGTGGCATCTGGGGTGGCGAGGCCGTGATCAAGGGCTTT
CAGAAACGCGAGCAAACAAAGCGTCGCGTGCCGCACTTTTGGGTACCAAA
TCTTAGGCGTTCGGTGGTCCATAGTCATGTGCTGGACTGCTACATGTCCG
TGGTGGTGACGGAACGCACGCTGGAGCAGATCCATGAATGTCATGGCTTT
GATCACTACCTCCTCAAGAATCGTGCCTGCGATCTTCGCTCCGCTTTGGC
TCTGAAACTCAAGCGAGAGGTGCTTCAGGCCCTGCAGAACGGTGTTCCAG
CCCTCGCCGACGAGCCCGAACGCCAACAGGAAGTGCTTAAGGAATACCGC
CGCTATCTGGAACCATATACGCCCGAGGAAATCGATTGGTACGGCCATAC
CTATTTGGAGGCCATACGCAAGCTGCAAAAGCAGCTGCGCGAAGCGGAAA
AAGTGGTGCCGCATAAGTTGGAGTTCCGCGGAAAGCTTATCGAGCAGCTG
CGCCAGGCGGGGATCAGCGAAGCGGGAAAGCTGGAGAAGCCGGATGCATT
AGCAGCAGAATCGTCGGTCGAACACAAGGATTCGGATATCGAAGCGCTTA
CAAAGCTGGAATCCTCCCCCTCTTCCAGTTGGCTGTCTAAAATCAATCCT
TTCGGCAAGAAAGAAACCTAGAAAAGCTGTCCGCGTTTGTTTTTGATTTA
TGTGTTTAGCCTCGAACGAATAAACATAACTTCGGAAACATTTCGTTACA
ATTTGAAGGTATTAAAACGTTAAAAAAAAAAAAAAAAAA

IP19992.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-RA 1462 mRpL28-RA 164..1284 1..1121 5590 99.9 Plus
mRpL28.a 1222 mRpL28.a 123..1079 1..957 4770 99.8 Plus
mRpL28.a 1222 mRpL28.a 1080..1222 979..1121 715 100 Plus
Gmd-RA 1756 Gmd-RA 1691..1756 1121..1056 330 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4973374..4974201 131..958 4125 99.9 Plus
chr2L 23010047 chr2L 4974253..4974416 958..1121 820 100 Plus
chr2L 23010047 chr2L 4973125..4973258 1..134 670 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4974274..4975101 131..958 4125 99.9 Plus
2L 23513712 2L 4975153..4975316 958..1121 820 100 Plus
2L 23513712 2L 4974025..4974158 1..134 670 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4974274..4975101 131..958 4125 99.8 Plus
2L 23513712 2L 4975153..4975316 958..1121 820 100 Plus
2L 23513712 2L 4974025..4974158 1..134 670 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:53:09 has no hits.

IP19992.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:53:54 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4973125..4973257 1..133 100 -> Plus
chr2L 4973377..4974200 134..957 99 -> Plus
chr2L 4974253..4974416 958..1121 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:17:42 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 1..909 113..1021 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:57 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 1..909 113..1021 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:00 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 1..909 113..1021 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:10:41 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 1..909 113..1021 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:09:19 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 1..909 113..1021 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:31:29 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 48..1135 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:57 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 48..1136 1..1089 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:00 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RB 50..1170 1..1121 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:10:41 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 48..1135 1..1088 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:09:19 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RB 50..1170 1..1121 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:54 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4974025..4974157 1..133 100 -> Plus
2L 4974277..4975100 134..957 99 -> Plus
2L 4975153..4975316 958..1121 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:54 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4974025..4974157 1..133 100 -> Plus
2L 4974277..4975100 134..957 99 -> Plus
2L 4975153..4975316 958..1121 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:53:54 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4974025..4974157 1..133 100 -> Plus
2L 4974277..4975100 134..957 99 -> Plus
2L 4975153..4975316 958..1121 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:00 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4974025..4974157 1..133 100 -> Plus
arm_2L 4974277..4975100 134..957 99 -> Plus
arm_2L 4975153..4975316 958..1121 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:10 Download gff for IP19992.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4974277..4975100 134..957 99 -> Plus
2L 4975153..4975316 958..1121 100   Plus
2L 4974025..4974157 1..133 100 -> Plus

IP19992.pep Sequence

Translation from 112 to 1020

> IP19992.pep
MAHATPQGVKLLNGWKRPGRFDKGLGAQLPEAYRKFWREWKLTTPAAVHY
IPKEQQWERDEVTHAIKPVQNIPLPLIDTPESHRGIWGGEAVIKGFQKRE
QTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLEQIHECHGFDHYL
LKNRACDLRSALALKLKREVLQALQNGVPALADEPERQQEVLKEYRRYLE
PYTPEEIDWYGHTYLEAIRKLQKQLREAEKVVPHKLEFRGKLIEQLRQAG
ISEAGKLEKPDALAAESSVEHKDSDIEALTKLESSPSSSWLSKINPFGKK
ET*

IP19992.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23657-PA 301 GF23657-PA 1..301 1..302 1429 93 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25036-PA 301 GG25036-PA 1..301 1..302 1532 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10245-PA 300 GH10245-PA 1..300 1..302 1252 81.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-PB 302 CG3782-PB 1..302 1..302 1604 100 Plus
mRpL28-PA 302 CG3782-PA 1..302 1..302 1604 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15386-PA 300 GI15386-PA 1..300 1..302 1238 80.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26538-PA 301 GL26538-PA 1..301 1..302 1353 85.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17686-PA 301 GA17686-PA 1..301 1..302 1353 85.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18510-PA 302 GM18510-PA 1..302 1..302 1553 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23314-PA 302 GD23314-PA 1..302 1..302 1554 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17276-PA 300 GJ17276-PA 1..300 1..302 1276 83.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24462-PA 302 GK24462-PA 1..302 1..302 1312 85 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11277-PA 301 GE11277-PA 1..301 1..302 1462 95.4 Plus

IP19992.hyp Sequence

Translation from 112 to 1020

> IP19992.hyp
MAHATPQGVKLLNGWKRPGRFDKGLGAQLPEAYRKFWREWKLTTPAAVHY
IPKEQQWERDEVTHAIKPVQNIPLPLIDTPESHRGIWGGEAVIKGFQKRE
QTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLEQIHECHGFDHYL
LKNRACDLRSALALKLKREVLQALQNGVPALADEPERQQEVLKEYRRYLE
PYTPEEIDWYGHTYLEAIRKLQKQLREAEKVVPHKLEFRGKLIEQLRQAG
ISEAGKLEKPDALAAESSVEHKDSDIEALTKLESSPSSSWLSKINPFGKK
ET*

IP19992.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-PB 302 CG3782-PB 1..302 1..302 1604 100 Plus
mRpL28-PA 302 CG3782-PA 1..302 1..302 1604 100 Plus