Clone IP20063 Report

Search the DGRC for IP20063

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:200
Well:63
Vector:pOT2
Associated Gene/TranscriptCG33276-RB
Protein status:IP20063.pep: gold
Sequenced Size:405

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33276 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP20063.complete Sequence

405 bp assembled on 2009-04-10

GenBank Submission: BT082024.1

> IP20063.complete
ATATGATGGGCACGCCGGAATTAAAAATCATATTAGAATTCAGTGCAGGG
GCGGAGTTACTATTTGGTAACATAAAACGCCGTGAATTGAACTTGGACGG
TAAACAAAAATGGACTATTGCTAATCTGCTTAAGTGGATGCATGCGAATA
TTTTAACGGAGCGTCCGGAACTTTTTCTTCAAGGAGATACTGTGCGACCT
GGAATTTTAGTACTCATAAATGATACAGACTGGGAATTGCTGGGTGAACT
GGACTACGAGCTGCAGCCCAACGACAATGTGTTGTTTATATCAACTTTAC
ACGGTGGTTAAAAAACGTTCTGGAATCTAAATTATAGGAGAAAAGTTTAT
TTTTATACTACAACCCATTAAATTGTATTCAAAAAACAAAAAAAAAAAAA
AAAAA

IP20063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG33276-RB 510 CG33276-RB 42..437 1..396 1965 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7631910..7632055 387..242 700 98.6 Minus
chr3L 24539361 chr3L 7632219..7632305 194..108 420 98.9 Minus
chr3L 24539361 chr3L 7632367..7632434 109..42 340 100 Minus
chr3L 24539361 chr3L 7632110..7632159 243..194 250 100 Minus
chr3L 24539361 chr3L 7632499..7632541 43..1 200 97.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7639806..7639960 396..242 760 99.4 Minus
3L 28110227 3L 7640124..7640210 194..108 420 98.9 Minus
3L 28110227 3L 7640269..7640339 112..42 355 100 Minus
3L 28110227 3L 7640015..7640064 243..194 250 100 Minus
3L 28110227 3L 7640404..7640446 43..1 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7632906..7633060 396..242 760 99.3 Minus
3L 28103327 3L 7633224..7633310 194..108 420 98.8 Minus
3L 28103327 3L 7633369..7633439 112..42 355 100 Minus
3L 28103327 3L 7633115..7633164 243..194 250 100 Minus
3L 28103327 3L 7633504..7633546 43..1 215 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:09:40 has no hits.

IP20063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:40 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7631910..7632054 243..387 98 <- Minus
chr3L 7632111..7632159 194..242 100 <- Minus
chr3L 7632220..7632301 112..193 100 <- Minus
chr3L 7632365..7632432 44..111 98 <- Minus
chr3L 7632499..7632541 1..43 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:14 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..306 6..311 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:21 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..306 6..311 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:17 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..306 6..311 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:39 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..306 6..311 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:29:45 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..309 3..311 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:21 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..387 1..387 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:17 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..387 1..387 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:39 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
CG33276-RB 1..387 1..387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:40 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7639815..7639959 243..387 100 <- Minus
3L 7640016..7640064 194..242 100 <- Minus
3L 7640125..7640206 112..193 100 <- Minus
3L 7640270..7640337 44..111 100 <- Minus
3L 7640404..7640446 1..43 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:40 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7639815..7639959 243..387 100 <- Minus
3L 7640016..7640064 194..242 100 <- Minus
3L 7640125..7640206 112..193 100 <- Minus
3L 7640270..7640337 44..111 100 <- Minus
3L 7640404..7640446 1..43 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:40 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7639815..7639959 243..387 100 <- Minus
3L 7640016..7640064 194..242 100 <- Minus
3L 7640125..7640206 112..193 100 <- Minus
3L 7640270..7640337 44..111 100 <- Minus
3L 7640404..7640446 1..43 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:17 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7632915..7633059 243..387 100 <- Minus
arm_3L 7633116..7633164 194..242 100 <- Minus
arm_3L 7633225..7633306 112..193 100 <- Minus
arm_3L 7633370..7633437 44..111 100 <- Minus
arm_3L 7633504..7633546 1..43 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:37 Download gff for IP20063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7632915..7633059 243..387 100 <- Minus
3L 7633116..7633164 194..242 100 <- Minus
3L 7633225..7633306 112..193 100 <- Minus
3L 7633370..7633437 44..111 100 <- Minus
3L 7633504..7633546 1..43 100   Minus

IP20063.hyp Sequence

Translation from 2 to 310

> IP20063.hyp
MMGTPELKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANI
LTERPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLH
GG*

IP20063.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33276-PB 101 CG33276-PB 1..101 2..102 529 100 Plus

IP20063.pep Sequence

Translation from 2 to 310

> IP20063.pep
MMGTPELKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANI
LTERPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLH
GG*

IP20063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23776-PA 101 GF23776-PA 1..101 2..102 487 94.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14947-PA 132 GG14947-PA 31..132 1..102 512 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16604-PA 104 GH16604-PA 6..104 4..102 406 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Urm1-PB 101 CG33276-PB 1..101 2..102 529 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12450-PA 104 GI12450-PA 6..104 4..102 420 91.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24132-PA 99 GL24132-PA 3..99 6..102 464 93.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23607-PA 99 GA23607-PA 3..99 6..102 464 93.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13742-PA 101 GM13742-PA 1..101 2..102 498 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13043-PA 101 GD13043-PA 1..101 2..102 495 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12350-PA 99 GJ12350-PA 2..99 5..102 464 92.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16796-PA 100 GK16796-PA 4..100 6..102 434 84.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20399-PA 101 GE20399-PA 1..101 2..102 503 98 Plus