BDGP Sequence Production Resources |
Search the DGRC for IP20063
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 200 |
Well: | 63 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33276-RB |
Protein status: | IP20063.pep: gold |
Sequenced Size: | 405 |
Gene | Date | Evidence |
---|---|---|
CG33276 | 2008-05-05 | Release 5.5 slip selected |
405 bp assembled on 2009-04-10
GenBank Submission: BT082024.1
> IP20063.complete ATATGATGGGCACGCCGGAATTAAAAATCATATTAGAATTCAGTGCAGGG GCGGAGTTACTATTTGGTAACATAAAACGCCGTGAATTGAACTTGGACGG TAAACAAAAATGGACTATTGCTAATCTGCTTAAGTGGATGCATGCGAATA TTTTAACGGAGCGTCCGGAACTTTTTCTTCAAGGAGATACTGTGCGACCT GGAATTTTAGTACTCATAAATGATACAGACTGGGAATTGCTGGGTGAACT GGACTACGAGCTGCAGCCCAACGACAATGTGTTGTTTATATCAACTTTAC ACGGTGGTTAAAAAACGTTCTGGAATCTAAATTATAGGAGAAAAGTTTAT TTTTATACTACAACCCATTAAATTGTATTCAAAAAACAAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33276-RB | 510 | CG33276-RB | 42..437 | 1..396 | 1965 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 7631910..7632055 | 387..242 | 700 | 98.6 | Minus |
chr3L | 24539361 | chr3L | 7632219..7632305 | 194..108 | 420 | 98.9 | Minus |
chr3L | 24539361 | chr3L | 7632367..7632434 | 109..42 | 340 | 100 | Minus |
chr3L | 24539361 | chr3L | 7632110..7632159 | 243..194 | 250 | 100 | Minus |
chr3L | 24539361 | chr3L | 7632499..7632541 | 43..1 | 200 | 97.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 7639806..7639960 | 396..242 | 760 | 99.4 | Minus |
3L | 28110227 | 3L | 7640124..7640210 | 194..108 | 420 | 98.9 | Minus |
3L | 28110227 | 3L | 7640269..7640339 | 112..42 | 355 | 100 | Minus |
3L | 28110227 | 3L | 7640015..7640064 | 243..194 | 250 | 100 | Minus |
3L | 28110227 | 3L | 7640404..7640446 | 43..1 | 215 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 7632906..7633060 | 396..242 | 760 | 99.3 | Minus |
3L | 28103327 | 3L | 7633224..7633310 | 194..108 | 420 | 98.8 | Minus |
3L | 28103327 | 3L | 7633369..7633439 | 112..42 | 355 | 100 | Minus |
3L | 28103327 | 3L | 7633115..7633164 | 243..194 | 250 | 100 | Minus |
3L | 28103327 | 3L | 7633504..7633546 | 43..1 | 215 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 7631910..7632054 | 243..387 | 98 | <- | Minus |
chr3L | 7632111..7632159 | 194..242 | 100 | <- | Minus |
chr3L | 7632220..7632301 | 112..193 | 100 | <- | Minus |
chr3L | 7632365..7632432 | 44..111 | 98 | <- | Minus |
chr3L | 7632499..7632541 | 1..43 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..306 | 6..311 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..306 | 6..311 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..306 | 6..311 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..306 | 6..311 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..309 | 3..311 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..387 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..387 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33276-RB | 1..387 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 7639815..7639959 | 243..387 | 100 | <- | Minus |
3L | 7640016..7640064 | 194..242 | 100 | <- | Minus |
3L | 7640125..7640206 | 112..193 | 100 | <- | Minus |
3L | 7640270..7640337 | 44..111 | 100 | <- | Minus |
3L | 7640404..7640446 | 1..43 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 7639815..7639959 | 243..387 | 100 | <- | Minus |
3L | 7640016..7640064 | 194..242 | 100 | <- | Minus |
3L | 7640125..7640206 | 112..193 | 100 | <- | Minus |
3L | 7640270..7640337 | 44..111 | 100 | <- | Minus |
3L | 7640404..7640446 | 1..43 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 7639815..7639959 | 243..387 | 100 | <- | Minus |
3L | 7640016..7640064 | 194..242 | 100 | <- | Minus |
3L | 7640125..7640206 | 112..193 | 100 | <- | Minus |
3L | 7640270..7640337 | 44..111 | 100 | <- | Minus |
3L | 7640404..7640446 | 1..43 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 7632915..7633059 | 243..387 | 100 | <- | Minus |
arm_3L | 7633116..7633164 | 194..242 | 100 | <- | Minus |
arm_3L | 7633225..7633306 | 112..193 | 100 | <- | Minus |
arm_3L | 7633370..7633437 | 44..111 | 100 | <- | Minus |
arm_3L | 7633504..7633546 | 1..43 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 7632915..7633059 | 243..387 | 100 | <- | Minus |
3L | 7633116..7633164 | 194..242 | 100 | <- | Minus |
3L | 7633225..7633306 | 112..193 | 100 | <- | Minus |
3L | 7633370..7633437 | 44..111 | 100 | <- | Minus |
3L | 7633504..7633546 | 1..43 | 100 | Minus |
Translation from 2 to 310
> IP20063.hyp MMGTPELKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANI LTERPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLH GG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33276-PB | 101 | CG33276-PB | 1..101 | 2..102 | 529 | 100 | Plus |
Translation from 2 to 310
> IP20063.pep MMGTPELKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANI LTERPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLH GG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23776-PA | 101 | GF23776-PA | 1..101 | 2..102 | 487 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14947-PA | 132 | GG14947-PA | 31..132 | 1..102 | 512 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16604-PA | 104 | GH16604-PA | 6..104 | 4..102 | 406 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Urm1-PB | 101 | CG33276-PB | 1..101 | 2..102 | 529 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12450-PA | 104 | GI12450-PA | 6..104 | 4..102 | 420 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24132-PA | 99 | GL24132-PA | 3..99 | 6..102 | 464 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23607-PA | 99 | GA23607-PA | 3..99 | 6..102 | 464 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13742-PA | 101 | GM13742-PA | 1..101 | 2..102 | 498 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13043-PA | 101 | GD13043-PA | 1..101 | 2..102 | 495 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12350-PA | 99 | GJ12350-PA | 2..99 | 5..102 | 464 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16796-PA | 100 | GK16796-PA | 4..100 | 6..102 | 434 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20399-PA | 101 | GE20399-PA | 1..101 | 2..102 | 503 | 98 | Plus |