Clone IP20115 Report

Search the DGRC for IP20115

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:201
Well:15
Vector:pOT2
Associated Gene/TranscriptCG32448-RB
Protein status:IP20115.pep: gold
Sequenced Size:368

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32448 2008-04-29 Release 5.5 accounting
CG32448 2008-05-05 Release 5.5 slip selected
CG32448 2008-08-15 Release 5.9 accounting
CG32448 2008-12-18 5.12 accounting

Clone Sequence Records

IP20115.complete Sequence

368 bp assembled on 2007-07-19

GenBank Submission: BT030962

> IP20115.complete
AGCATTTAGTGGAGAAGACGACGAGGATGAGCGAAGGAAAGCAGCAGGGT
CCTGGCGATGGCATCCGATCCATGCGAAGCACCGGAGTCTTCCGGCTGAT
CAACTTCGAGTTGTACACCAAGCCGAACAAGATTATCATGGGCCTGGGAC
TGACCGCGATTGCCGGGGTCTTCGGCTACATCGCGTATATGAGGTACAAG
TACGAGAGCTTGGGATACTATGTGGCTGTCCAGGAGAACGGACAGGAGAA
GTTCATCAAGAAGAAGTCGAATTGGGAGCAGTAATCCGCAGATTTTGGTG
GAAACATCTTTATTACTTGGTAGCACAATTTGGTACATAAATTTGTTGTT
TACGGGAAAAAAAAAAAA

IP20115.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32448-RB 527 CG32448-RB 141..497 1..357 1785 100 Plus
CG7414-RA 2638 CG7414-RA 2509..2638 357..228 650 100 Minus
CG7414-RB 2644 CG7414-RB 2559..2644 357..272 430 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21816709..21816940 356..125 1160 100 Minus
chr3L 24539361 chr3L 21817006..21817130 125..1 625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21827773..21828005 357..125 1165 100 Minus
3L 28110227 3L 21828071..21828195 125..1 625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21820873..21821105 357..125 1165 100 Minus
3L 28103327 3L 21821171..21821295 125..1 625 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:05:25 has no hits.

IP20115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:06:02 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21817006..21817130 1..125 100   Minus
chr3L 21816709..21816939 126..356 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:18:48 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..258 27..284 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:52 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RC 1..258 27..284 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:43 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..258 27..284 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:10:23 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..258 27..284 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:49 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..258 27..284 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:31:23 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..260 25..284 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:52 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RC 161..516 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:43 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:10:23 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..260 25..284 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:49 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
CG32448-RB 1..356 1..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:06:02 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21827774..21828004 126..356 100 <- Minus
3L 21828071..21828195 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:06:02 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21827774..21828004 126..356 100 <- Minus
3L 21828071..21828195 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:06:02 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21827774..21828004 126..356 100 <- Minus
3L 21828071..21828195 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:43 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21820874..21821104 126..356 100 <- Minus
arm_3L 21821171..21821295 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:05 Download gff for IP20115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21820874..21821104 126..356 100 <- Minus
3L 21821171..21821295 1..125 100   Minus

IP20115.hyp Sequence

Translation from 0 to 339

> IP20115.hyp
AFSGEDDEDERRKAAGSWRWHPIHAKHRSLPADQLRVVHQAEQDYHGPGT
DRDCRGLRLHRVYEVQVRELGILCGCPGERTGEVHQEEVELGAVIRRFWW
KHLYYLVAQFGT*
Sequence IP20115.hyp has no blast hits.

IP20115.pep Sequence

Translation from 2 to 283

> IP20115.pep
HLVEKTTRMSEGKQQGPGDGIRSMRSTGVFRLINFELYTKPNKIIMGLGL
TAIAGVFGYIAYMRYKYESLGYYVAVQENGQEKFIKKKSNWEQ*

IP20115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23505-PA 85 GF23505-PA 1..85 9..93 397 85.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13198-PA 85 GG13198-PA 1..85 9..93 438 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17140-PA 86 GH17140-PA 1..85 9..92 352 76.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32448-PC 85 CG32448-PC 1..85 9..93 444 100 Plus
CG32448-PB 85 CG32448-PB 1..85 9..93 444 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11749-PA 85 GI11749-PA 1..84 9..92 375 82.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25326-PA 85 GL25326-PA 1..84 9..92 392 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16913-PA 85 GA16913-PA 1..84 9..92 392 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22108-PA 85 GM22108-PA 1..85 9..93 442 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12084-PA 85 GD12084-PA 1..85 9..93 442 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13458-PA 85 GJ13458-PA 1..84 9..92 375 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17421-PA 88 GK17421-PA 1..87 9..92 367 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19521-PA 85 GE19521-PA 1..85 9..93 422 95.3 Plus