BDGP Sequence Production Resources |
Search the DGRC for IP20115
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 201 |
Well: | 15 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32448-RB |
Protein status: | IP20115.pep: gold |
Sequenced Size: | 368 |
Gene | Date | Evidence |
---|---|---|
CG32448 | 2008-04-29 | Release 5.5 accounting |
CG32448 | 2008-05-05 | Release 5.5 slip selected |
CG32448 | 2008-08-15 | Release 5.9 accounting |
CG32448 | 2008-12-18 | 5.12 accounting |
368 bp assembled on 2007-07-19
GenBank Submission: BT030962
> IP20115.complete AGCATTTAGTGGAGAAGACGACGAGGATGAGCGAAGGAAAGCAGCAGGGT CCTGGCGATGGCATCCGATCCATGCGAAGCACCGGAGTCTTCCGGCTGAT CAACTTCGAGTTGTACACCAAGCCGAACAAGATTATCATGGGCCTGGGAC TGACCGCGATTGCCGGGGTCTTCGGCTACATCGCGTATATGAGGTACAAG TACGAGAGCTTGGGATACTATGTGGCTGTCCAGGAGAACGGACAGGAGAA GTTCATCAAGAAGAAGTCGAATTGGGAGCAGTAATCCGCAGATTTTGGTG GAAACATCTTTATTACTTGGTAGCACAATTTGGTACATAAATTTGTTGTT TACGGGAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21817006..21817130 | 1..125 | 100 | Minus | |
chr3L | 21816709..21816939 | 126..356 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..258 | 27..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RC | 1..258 | 27..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..258 | 27..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..258 | 27..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..258 | 27..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..260 | 25..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RC | 161..516 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..260 | 25..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32448-RB | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21827774..21828004 | 126..356 | 100 | <- | Minus |
3L | 21828071..21828195 | 1..125 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21827774..21828004 | 126..356 | 100 | <- | Minus |
3L | 21828071..21828195 | 1..125 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21827774..21828004 | 126..356 | 100 | <- | Minus |
3L | 21828071..21828195 | 1..125 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21820874..21821104 | 126..356 | 100 | <- | Minus |
arm_3L | 21821171..21821295 | 1..125 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21820874..21821104 | 126..356 | 100 | <- | Minus |
3L | 21821171..21821295 | 1..125 | 100 | Minus |
Translation from 0 to 339
> IP20115.hyp AFSGEDDEDERRKAAGSWRWHPIHAKHRSLPADQLRVVHQAEQDYHGPGT DRDCRGLRLHRVYEVQVRELGILCGCPGERTGEVHQEEVELGAVIRRFWW KHLYYLVAQFGT*
Translation from 2 to 283
> IP20115.pep HLVEKTTRMSEGKQQGPGDGIRSMRSTGVFRLINFELYTKPNKIIMGLGL TAIAGVFGYIAYMRYKYESLGYYVAVQENGQEKFIKKKSNWEQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23505-PA | 85 | GF23505-PA | 1..85 | 9..93 | 397 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13198-PA | 85 | GG13198-PA | 1..85 | 9..93 | 438 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17140-PA | 86 | GH17140-PA | 1..85 | 9..92 | 352 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32448-PC | 85 | CG32448-PC | 1..85 | 9..93 | 444 | 100 | Plus |
CG32448-PB | 85 | CG32448-PB | 1..85 | 9..93 | 444 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11749-PA | 85 | GI11749-PA | 1..84 | 9..92 | 375 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25326-PA | 85 | GL25326-PA | 1..84 | 9..92 | 392 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16913-PA | 85 | GA16913-PA | 1..84 | 9..92 | 392 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22108-PA | 85 | GM22108-PA | 1..85 | 9..93 | 442 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12084-PA | 85 | GD12084-PA | 1..85 | 9..93 | 442 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13458-PA | 85 | GJ13458-PA | 1..84 | 9..92 | 375 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17421-PA | 88 | GK17421-PA | 1..87 | 9..92 | 367 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19521-PA | 85 | GE19521-PA | 1..85 | 9..93 | 422 | 95.3 | Plus |