Clone IP20138 Report

Search the DGRC for IP20138

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:201
Well:38
Vector:pOT2
Associated Gene/TranscriptCG11041-RB
Protein status:IP20138.pep: gold
Sequenced Size:546

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11041 2008-04-29 Release 5.5 accounting
CG11041 2008-05-05 Release 5.5 slip selected
CG11041 2008-08-15 Release 5.9 accounting
CG11041 2008-12-18 5.12 accounting

Clone Sequence Records

IP20138.complete Sequence

546 bp assembled on 2008-05-14

GenBank Submission: BT030969

> IP20138.complete
CTCAAGCCTTTAACATGGATATGGATTTGAATAACGACTTGGAGAAACGC
ATTTCGGATGCCTTTTGTGTGTTCGATCATCATGGCGACAAGTTCATCGA
CGTTAGAGAAGTGGGCACTGTGCTGAGACTCCTGGGCTGTGTTCCCACCG
AGGAGGAGGTGAACGAAGTAATTTCGGCTACAGAATCGGAGGAGACCAGT
GGCGAAGTGCATTTGACTAAATTTTTGCCACACGTCTCGCAACTGCTCAT
GGAAAGAAAAATGGAGCCTGCTCCGCCAGAGAAAATTCTCCAGGCCTTTA
AGATCTTGGATCCGGAGAACAAGGGCTATCTCACCAAGGAGAGCTTTGGC
AAACTGATGATGGAGGAGGGCGAGCCTTTCACCCAAGAGGAAATGGACGA
AATGTGGCCAGTGGCCATAGACCCAATTAGCGGACACATACCCTATGAGT
TCTACCTGAATCAGCTCATGGTCTATCTGTAAGGGAAACAGAGTGCTTTA
ATAAAGATTCCAATTTAAGTCTAAAAAAAAAAAAAAAAAAAAAAAA

IP20138.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG11041-RB 767 CG11041-RB 162..684 1..523 2615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16033384..16033615 28..259 1115 98.7 Plus
chr2R 21145070 chr2R 16033671..16033883 260..472 1035 99.1 Plus
chr2R 21145070 chr2R 16033942..16033994 470..522 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20146214..20146445 28..259 1160 100 Plus
2R 25286936 2R 20146501..20146713 260..472 1065 100 Plus
2R 25286936 2R 20146772..20146825 470..523 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20147413..20147644 28..259 1160 100 Plus
2R 25260384 2R 20147700..20147912 260..472 1065 100 Plus
2R 25260384 2R 20147971..20148024 470..523 270 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:49:25 has no hits.

IP20138.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:50:08 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16033671..16033881 260..470 99 -> Plus
chr2R 16033943..16033994 471..522 100   Plus
chr2R 16033303..16033329 1..27 100 -> Plus
chr2R 16033384..16033615 28..259 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:05 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RA 1..458 15..472 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:23 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 1..468 15..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:42 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 1..468 15..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:35 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RA 1..458 15..472 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:20:07 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 1..468 15..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:16 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RA 1..458 15..472 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:23 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:42 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 16..537 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:37 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RA 1..458 15..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:20:07 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
CG11041-RB 16..537 1..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:50:08 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20146501..20146711 260..470 100 -> Plus
2R 20146773..20146824 471..522 100   Plus
2R 20146133..20146159 1..27 100 -> Plus
2R 20146214..20146445 28..259 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:50:08 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20146501..20146711 260..470 100 -> Plus
2R 20146773..20146824 471..522 100   Plus
2R 20146133..20146159 1..27 100 -> Plus
2R 20146214..20146445 28..259 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:50:08 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20146501..20146711 260..470 100 -> Plus
2R 20146773..20146824 471..522 100   Plus
2R 20146133..20146159 1..27 100 -> Plus
2R 20146214..20146445 28..259 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:42 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16033638..16033664 1..27 100 -> Plus
arm_2R 16033719..16033950 28..259 100 -> Plus
arm_2R 16034006..16034216 260..470 100 -> Plus
arm_2R 16034278..16034329 471..522 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:20 Download gff for IP20138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20147332..20147358 1..27 100 -> Plus
2R 20147413..20147644 28..259 100 -> Plus
2R 20147700..20147910 260..470 100 -> Plus
2R 20147972..20148023 471..522 100   Plus

IP20138.hyp Sequence

Translation from 2 to 481

> IP20138.hyp
QAFNMDMDLNNDLEKRISDAFCVFDHHGDKFIDVREVGTVLRLLGCVPTE
EEVNEVISATESEETSGEVHLTKFLPHVSQLLMERKMEPAPPEKILQAFK
ILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEMWPVAIDPISGHIPYEF
YLNQLMVYL*

IP20138.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG11041-PB 155 CG11041-PB 1..155 5..159 816 100 Plus
CG9406-PA 186 CG9406-PA 7..153 9..155 569 70.1 Plus
Cam-PD 149 CG8472-PD 15..146 19..155 184 32.6 Plus
Cam-PC 149 CG8472-PC 15..146 19..155 184 32.6 Plus
Cam-PE 149 CG8472-PE 15..146 19..155 184 32.6 Plus

IP20138.pep Sequence

Translation from 2 to 481

> IP20138.pep
QAFNMDMDLNNDLEKRISDAFCVFDHHGDKFIDVREVGTVLRLLGCVPTE
EEVNEVISATESEETSGEVHLTKFLPHVSQLLMERKMEPAPPEKILQAFK
ILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEMWPVAIDPISGHIPYEF
YLNQLMVYL*

IP20138.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11744-PA 155 GF11744-PA 1..155 5..159 816 99.4 Plus
Dana\GF12975-PA 190 GF12975-PA 5..153 7..155 569 69.1 Plus
Dana\GF12835-PA 149 GF12835-PA 16..146 20..155 190 32.8 Plus
Dana\GF16771-PA 165 GF16771-PA 20..162 8..155 173 29.7 Plus
Dana\GF16770-PA 165 GF16770-PA 20..163 8..156 171 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22012-PA 219 GG22012-PA 1..153 5..157 807 99.3 Plus
Dere\GG22090-PA 186 GG22090-PA 7..153 9..155 573 69.4 Plus
Dere\GG20265-PA 149 GG20265-PA 16..146 20..155 190 32.8 Plus
Dere\GG11425-PA 148 GG11425-PA 14..142 19..152 176 33.6 Plus
Dere\GG21382-PA 182 GG21382-PA 43..173 17..152 166 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23029-PA 155 GH23029-PA 1..155 5..159 769 93.5 Plus
Dgri\GH20721-PA 191 GH20721-PA 7..153 9..155 565 68.7 Plus
Dgri\GH23405-PA 151 GH23405-PA 18..145 20..152 161 31.6 Plus
Dgri\GH10976-PA 190 GH10976-PA 51..181 17..152 150 30.1 Plus
Dgri\GH22800-PA 122 GH22800-PA 19..108 20..114 144 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11041-PB 155 CG11041-PB 1..155 5..159 816 100 Plus
CG9406-PA 186 CG9406-PA 7..153 9..155 569 70.1 Plus
Cam-PD 149 CG8472-PD 15..146 19..155 184 32.6 Plus
Cam-PC 149 CG8472-PC 15..146 19..155 184 32.6 Plus
Cam-PE 149 CG8472-PE 15..146 19..155 184 32.6 Plus
Cam-PB 149 CG8472-PB 15..146 19..155 184 32.6 Plus
Cam-PA 149 CG8472-PA 15..146 19..155 184 32.6 Plus
Acam-PB 148 CG17769-PB 3..142 8..152 181 32.4 Plus
Acam-PA 148 CG17769-PA 3..142 8..152 181 32.4 Plus
CG17493-PD 182 CG17493-PD 43..173 17..152 169 31.6 Plus
CG17493-PC 182 CG17493-PC 43..173 17..152 169 31.6 Plus
CG17493-PB 182 CG17493-PB 43..173 17..152 169 31.6 Plus
CG5024-PB 165 CG5024-PB 21..141 9..134 148 27.8 Plus
CG5024-PA 165 CG5024-PA 21..141 9..134 148 27.8 Plus
azot-PA 148 CG11165-PA 3..145 8..155 146 23.6 Plus
Mlc-c-PB 153 CG3201-PB 16..151 15..156 137 26.1 Plus
TpnC47D-PB 155 CG9073-PB 3..152 4..155 137 23.7 Plus
TpnC47D-PA 155 CG9073-PA 3..152 4..155 137 23.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21100-PA 155 GI21100-PA 1..155 5..159 767 92.9 Plus
Dmoj\GI20806-PA 188 GI20806-PA 1..151 5..155 568 67.5 Plus
Dmoj\GI20594-PA 149 GI20594-PA 16..146 20..155 190 32.8 Plus
Dmoj\GI10339-PA 149 GI10339-PA 16..143 20..152 160 28.6 Plus
Dmoj\GI17489-PA 205 GI17489-PA 66..196 17..152 157 29.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10367-PA 155 GL10367-PA 1..155 5..159 813 98.7 Plus
Dper\GL10155-PA 181 GL10155-PA 7..153 9..155 512 70.7 Plus
Dper\GL10814-PA 149 GL10814-PA 16..146 20..155 190 32.8 Plus
Dper\GL11703-PA 149 GL11703-PA 14..147 17..155 165 32.4 Plus
Dper\GL21536-PA 148 GL21536-PA 14..142 19..152 163 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10723-PA 155 GA10723-PA 1..155 5..159 809 98.1 Plus
Dpse\GA25097-PB 181 GA25097-PB 7..153 9..155 515 70.1 Plus
Dpse\GA24499-PA 149 GA24499-PA 16..146 20..155 190 32.8 Plus
Dpse\GA24239-PA 149 GA24239-PA 14..147 17..155 164 32.4 Plus
Dpse\GA26322-PA 148 GA26322-PA 14..142 19..152 163 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21992-PA 215 GM21992-PA 1..153 5..157 802 98.7 Plus
Dsec\GM15808-PA 186 GM15808-PA 7..153 9..155 576 70.1 Plus
Dsec\GM21351-PA 149 GM21351-PA 16..146 20..155 190 32.8 Plus
Dsec\GM10265-PA 148 GM10265-PA 14..142 19..152 183 35.1 Plus
Dsec\GM19287-PA 182 GM19287-PA 43..173 17..152 169 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11492-PA 168 GD11492-PA 49..168 9..159 568 74.8 Plus
Dsim\GD11566-PA 148 GD11566-PA 1..115 41..155 421 67.8 Plus
Dsim\GD10849-PA 149 GD10849-PA 16..146 20..155 190 32.8 Plus
Dsim\GD21235-PA 148 GD21235-PA 14..142 19..152 183 35.1 Plus
Dsim\GD10523-PA 148 GD10523-PA 12..145 17..155 141 27.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20947-PA 155 GJ20947-PA 1..155 5..159 753 92.3 Plus
Dvir\GJ20539-PA 113 GJ20539-PA 1..81 75..155 283 65.4 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 6..145 8..152 171 29.7 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 51..182 17..153 152 29.9 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 45..175 17..152 144 30.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15902-PA 155 GK15902-PA 1..155 5..159 797 95.5 Plus
Dwil\GK20977-PA 182 GK20977-PA 3..149 9..155 483 70.7 Plus
Dwil\GK22183-PA 149 GK22183-PA 16..146 20..155 190 32.8 Plus
Dwil\GK18988-PA 148 GK18988-PA 14..142 19..152 176 32.1 Plus
Dwil\GK21454-PA 151 GK21454-PA 11..127 12..134 161 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12090-PA 227 GE12090-PA 1..153 5..157 804 99.3 Plus
Dyak\GE12170-PA 189 GE12170-PA 7..153 9..155 576 69.4 Plus
Dyak\Cam-PA 149 GE12425-PA 16..146 20..155 190 32.8 Plus
Dyak\GE23620-PA 148 GE23620-PA 14..142 19..152 172 32.8 Plus
Dyak\GE22671-PA 182 GE22671-PA 43..173 17..152 167 31.6 Plus