Clone IP20148 Report

Search the DGRC for IP20148

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:201
Well:48
Vector:pOT2
Protein status:IP20148.pep: Imported from assembly
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13905 2008-05-05 Release 5.5 slip selected
CG13905 2008-08-15 Release 5.9 accounting
CG13905 2008-12-18 5.12 accounting

Clone Sequence Records

IP20148.complete Sequence

926 bp assembled on 2008-05-27

GenBank Submission: BT032922

> IP20148.complete
GTTCATCGGTTGTGCTTTCTTGGGCTTCATGTGCCTGGTGGCTTTTCCCT
CTGCAACGCCGGCTATTTTGGCTCCGATCCGGCCATATGGTCAGAATGGA
ACCCTCGCTCAGCAGAACAACTTTGCCTTGGAGCTGAAGTCGGTGATTCG
ACAGATACCGGTGGACAACATCGAGAAGCTGGTTCAGACCTACCTCCTCA
ACGACATCGAGTTCCAAGGTGTGATCAGAGCCATTAACTCCCTACCCGCC
TATCGATTCTACCGCCAGTTGATCAACCAACCCGAAGTGCGCCAACTGCA
GCAGTGGATCACGCAGCAATTGATCCTGTCCGGCGGTGGACCCAAAATCT
TTGATTATCTAGAACTGGAGATCAAGATCTTGAACAAGTATCCCTATTGG
TCGCAGATCGTAAATGGAATCCAGGGATTCCAAGCGGAGTTCGTGCAGAT
CTACCCAGTGCAACTGATCCGATCCTTTCTGGAACCCAGTGCCACCCAAA
CAAGTCCTCAACTGTCGGAACTCTGGCGTCGTCTGGTGGCCTTGCGTCCA
GTTTACGAAAGAGTTTTGGCCACTCCACCCGGCAAGGCCATCACTGCTGA
ACTCCAGAGACTGGGCGTGGATGTGGGTGGTGTAGACGCCCTTATCCGTT
ATCAGTTCGGTTGGAGCAACGTCACCTTTCCGAGCTACGATTACACAGAT
TACCTGTACTAGAGATTCAATGTGGAACTGGCTATCAATAGATTATTCTT
ATGGACGAACCATAATAACCTCTCAAGTATTAACATATTAAGATATTAAT
GTGTGAAATGAATAGATATACATCATGGCAATTCTGGTCCAATATATTTA
GCATTACTTAACAAACATATATCGATTGAAAATACATGCTCAAAGGCGTA
AAGAACATAAAAAAAAAAAAAAAAAA

IP20148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13905-RB 904 CG13905-RB 6..904 1..899 4495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 902755..903662 1..908 4345 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 902903..903813 1..911 4555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 902903..903813 1..911 4555 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:34:17 has no hits.

IP20148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:35:27 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 902755..903662 1..908 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:17 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:01 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:02:26 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:13 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:44 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:46 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:01 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..913 1..908 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:02:26 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..913 1..908 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:46:13 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..717 1..712 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:44 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG13905-RB 6..913 1..908 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:35:27 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 902903..903810 1..908 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:35:27 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 902903..903810 1..908 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:35:27 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 902903..903810 1..908 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:02:26 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 902903..903810 1..908 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:05 Download gff for IP20148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 902903..903810 1..908 100   Plus

IP20148.hyp Sequence

Translation from 0 to 711

> IP20148.hyp
FIGCAFLGFMCLVAFPSATPAILAPIRPYGQNGTLAQQNNFALELKSVIR
QIPVDNIEKLVQTYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQ
QWITQQLILSGGGPKIFDYLELEIKILNKYPYWSQIVNGIQGFQAEFVQI
YPVQLIRSFLEPSATQTSPQLSELWRRLVALRPVYERVLATPPGKAITAE
LQRLGVDVGGVDALIRYQFGWSNVTFPSYDYTDYLY*

IP20148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13905-PB 238 CG13905-PB 3..238 1..236 1225 100 Plus
CG14963-PA 261 CG14963-PA 29..228 19..224 310 35.9 Plus

IP20148.pep Sequence

Translation from 1 to 711

> IP20148.pep
FIGCAFLGFMCLVAFPSATPAILAPIRPYGQNGTLAQQNNFALELKSVIR
QIPVDNIEKLVQTYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQ
QWITQQLILSGGGPKIFDYLELEIKILNKYPYWSQIVNGIQGFQAEFVQI
YPVQLIRSFLEPSATQTSPQLSELWRRLVALRPVYERVLATPPGKAITAE
LQRLGVDVGGVDALIRYQFGWSNVTFPSYDYTDYLY*

IP20148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24422-PA 237 GF24422-PA 4..237 2..236 823 74.3 Plus
Dana\GF10217-PA 260 GF10217-PA 5..230 7..226 290 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14747-PA 238 GG14747-PA 3..238 1..236 1085 87.7 Plus
Dere\GG14283-PA 263 GG14283-PA 50..229 44..225 277 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16870-PA 230 GH16870-PA 8..223 6..231 610 54.9 Plus
Dgri\GH22503-PA 230 GH22503-PA 7..223 5..231 604 54.2 Plus
Dgri\GH15258-PA 249 GH15258-PA 38..221 40..225 283 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13905-PB 238 CG13905-PB 3..238 1..236 1225 100 Plus
CG14963-PA 261 CG14963-PA 29..228 19..224 310 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11430-PA 241 GI11430-PA 39..238 36..236 614 60.9 Plus
Dmoj\GI11966-PA 244 GI11966-PA 9..214 9..221 288 34.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16910-PA 190 GL16910-PA 41..183 39..181 456 69.9 Plus
Dper\GL25249-PA 269 GL25249-PA 46..226 40..222 301 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12615-PA 241 GA12615-PA 9..240 6..236 617 60.1 Plus
Dpse\GA13388-PA 269 GA13388-PA 46..226 40..222 301 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14365-PA 238 GM14365-PA 3..238 1..236 1139 92.8 Plus
Dsec\GM14077-PA 263 GM14077-PA 50..228 44..224 287 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13583-PA 238 GD13583-PA 3..238 1..236 1140 92.8 Plus
Dsim\anon-Payne-PA 263 GD13352-PA 50..228 44..224 283 36.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13626-PA 234 GJ13626-PA 36..231 40..236 528 58.9 Plus
Dvir\GJ12191-PA 253 GJ12191-PA 25..234 20..228 283 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17364-PA 236 GK17364-PA 4..234 2..235 661 56 Plus
Dwil\GK13226-PA 240 GK13226-PA 26..205 42..222 326 40.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21109-PA 238 GE21109-PA 3..238 1..236 1125 90.7 Plus
Dyak\GE20712-PA 263 GE20712-PA 50..229 44..225 278 35.7 Plus