IP20196.complete Sequence
262 bp assembled on 2008-05-22
GenBank Submission: BT030982
> IP20196.complete
CTTTAGCGGATATCAACATGGCCTCAGTAAAATTGTTCTTTATTGCTATT
TTGGTTGTAGCTCTATCCCTTAACACCTCAGCTGCAGTGTTGAACCCTAG
TTCGACTGCCAAACCCAGATTTGAGACGAAAGACCGAAAACTAAGTGCTG
GCGCTCTGCAGTCACTCGCTGGTTAATTACTATAGAAAGCTATAGATAAA
ATTGTCATTATAAAAATGGACCAAAAATAAATTATTTTCAACGAAAAAAA
AAAAAAAAAAAA
IP20196.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:52:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-RA | 369 | Acp95EF-RA | 127..369 | 1..243 | 1215 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 20052427..20052635 | 35..243 | 1045 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24229071..24229281 | 35..245 | 1055 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 23969902..23970112 | 35..245 | 1055 | 100 | Plus |
3R | 31820162 | 3R | 23969806..23969840 | 1..35 | 175 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 21:18:37 has no hits.
IP20196.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:39 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 20052428..20052635 | 36..243 | 100 | | Plus |
chr3R | 20052331..20052365 | 1..35 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:36 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..159 | 18..176 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:38 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..159 | 18..176 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:57 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..159 | 18..176 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:28 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..159 | 18..176 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:10 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..159 | 18..176 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:56 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 320..562 | 1..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:38 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..243 | 1..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:57 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..243 | 1..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:28 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 320..562 | 1..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:10 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 1..243 | 1..243 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24229072..24229279 | 36..243 | 100 | | Plus |
3R | 24228975..24229009 | 1..35 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24229072..24229279 | 36..243 | 100 | | Plus |
3R | 24228975..24229009 | 1..35 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24229072..24229279 | 36..243 | 100 | | Plus |
3R | 24228975..24229009 | 1..35 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:57 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20054697..20054731 | 1..35 | 100 | -> | Plus |
arm_3R | 20054794..20055001 | 36..243 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:11 Download gff for
IP20196.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23969806..23969840 | 1..35 | 100 | -> | Plus |
3R | 23969903..23970110 | 36..243 | 100 | | Plus |
IP20196.hyp Sequence
Translation from 2 to 175
> IP20196.hyp
LADINMASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAG
ALQSLAG*
IP20196.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:06:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-PA | 52 | CG17924-PA | 1..52 | 6..57 | 242 | 100 | Plus |
IP20196.pep Sequence
Translation from 2 to 175
> IP20196.pep
LADINMASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAG
ALQSLAG*
IP20196.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-PA | 52 | CG17924-PA | 1..52 | 6..57 | 242 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26575-PA | 54 | GM26575-PA | 1..54 | 6..57 | 218 | 88.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21079-PA | 46 | GD21079-PA | 1..46 | 12..57 | 202 | 91.3 | Plus |