Clone IP20196 Report

Search the DGRC for IP20196

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:201
Well:96
Vector:pOT2
Associated Gene/TranscriptAcp95EF-RA
Protein status:IP20196.pep: gold
Sequenced Size:262

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Acp95EF 2008-04-29 Release 5.5 accounting
Spase22-23 2008-05-05 Release 5.5 slip selected
Acp95EF 2008-08-15 Release 5.9 accounting
Acp95EF 2008-12-18 5.12 accounting

Clone Sequence Records

IP20196.complete Sequence

262 bp assembled on 2008-05-22

GenBank Submission: BT030982

> IP20196.complete
CTTTAGCGGATATCAACATGGCCTCAGTAAAATTGTTCTTTATTGCTATT
TTGGTTGTAGCTCTATCCCTTAACACCTCAGCTGCAGTGTTGAACCCTAG
TTCGACTGCCAAACCCAGATTTGAGACGAAAGACCGAAAACTAAGTGCTG
GCGCTCTGCAGTCACTCGCTGGTTAATTACTATAGAAAGCTATAGATAAA
ATTGTCATTATAAAAATGGACCAAAAATAAATTATTTTCAACGAAAAAAA
AAAAAAAAAAAA

IP20196.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-RA 369 Acp95EF-RA 127..369 1..243 1215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20052427..20052635 35..243 1045 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24229071..24229281 35..245 1055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23969902..23970112 35..245 1055 100 Plus
3R 31820162 3R 23969806..23969840 1..35 175 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:18:37 has no hits.

IP20196.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:39 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20052428..20052635 36..243 100   Plus
chr3R 20052331..20052365 1..35 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:36 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..159 18..176 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:38 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..159 18..176 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:57 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..159 18..176 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:28 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..159 18..176 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:10 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..159 18..176 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:56 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 320..562 1..243 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:38 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..243 1..243 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:57 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..243 1..243 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:28 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 320..562 1..243 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:10 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 1..243 1..243 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24229072..24229279 36..243 100   Plus
3R 24228975..24229009 1..35 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24229072..24229279 36..243 100   Plus
3R 24228975..24229009 1..35 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:39 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24229072..24229279 36..243 100   Plus
3R 24228975..24229009 1..35 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:57 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20054697..20054731 1..35 100 -> Plus
arm_3R 20054794..20055001 36..243 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:11 Download gff for IP20196.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23969806..23969840 1..35 100 -> Plus
3R 23969903..23970110 36..243 100   Plus

IP20196.hyp Sequence

Translation from 2 to 175

> IP20196.hyp
LADINMASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAG
ALQSLAG*

IP20196.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-PA 52 CG17924-PA 1..52 6..57 242 100 Plus

IP20196.pep Sequence

Translation from 2 to 175

> IP20196.pep
LADINMASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAG
ALQSLAG*

IP20196.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-PA 52 CG17924-PA 1..52 6..57 242 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26575-PA 54 GM26575-PA 1..54 6..57 218 88.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21079-PA 46 GD21079-PA 1..46 12..57 202 91.3 Plus