BDGP Sequence Production Resources |
Search the DGRC for IP20205
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 202 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13028-RA |
Protein status: | IP20205.pep: gold |
Sequenced Size: | 761 |
Gene | Date | Evidence |
---|---|---|
CG13028 | 2008-05-05 | Release 5.5 slip selected |
CG13028 | 2008-08-15 | Release 5.9 accounting |
CG13028 | 2008-12-18 | 5.12 accounting |
761 bp assembled on 2008-05-14
GenBank Submission: BT032709
> IP20205.complete TTGGCCAAGGCGAAGCCAAAATTAGTGCACCCACAGTCCAGTGCCAGAGC GGATCTTCTCTTGACTTCGATCATCCGAAATGCAGTTCATCTATTTGACG CTGGCATTGGGGCTGATCTTCACCACTGCCCTTCAGGCGGCCATTATACC ACTGACCCTGATCAAAAACGGAATTGAAGCGAATTCCCAAGCACTTCCCA CGGATACGGAGAAGTTCGGTTACCTGGAATTCAAACCCAATGGATCACTA ATACTCAGAAGGGCGCCCAATCAGAGTGGCAGTAACCTACAGGACCTGGT AATGCTGAGAGGAGTTCTTCAGGCTCTGAAAGCGAGTCCCTCGAAAATGT CGGACATCGGTGGCGAAACGCGATTGAGCCTAAGGATTTATGGAGATGGA GTGGAACACAAGTTTCCGCCCATACTGGAGAATATCATTCAACGCATTCA AACGTATTTTTCGGTTTATCGCTTTACGGATACAAGCAAACCCGGTGGAT TGCAGCGAATTGAACTTACTACACAGCCGCCGGATGATTCTCCGGATGTA ACCACTGCAAAAGCCGAGAACGATGATGAACTGATAGCAGTCGGTGAGCA GGACGCGTACATTACAGTGGGGGATGATACAGACTAGAATTCACGCTATT TAATACATATTTATTCAACTAGCTATGTAAGACGATAAAAGTGCTGTAAT TTAAATATTTTTTAAAAATATATCACCCTCATTCGCAAATATCAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13028-RA | 743 | CG13028-RA | 1..743 | 1..743 | 3715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16912691..16913433 | 1..743 | 3610 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16923252..16923995 | 1..744 | 3720 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16916352..16917095 | 1..744 | 3720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16912691..16913433 | 1..743 | 95 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..743 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..743 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..558 | 80..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13028-RA | 1..743 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16923252..16923994 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16923252..16923994 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16923252..16923994 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16916352..16917094 | 1..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16916352..16917094 | 1..743 | 100 | Plus |
Translation from 79 to 636
> IP20205.pep MQFIYLTLALGLIFTTALQAAIIPLTLIKNGIEANSQALPTDTEKFGYLE FKPNGSLILRRAPNQSGSNLQDLVMLRGVLQALKASPSKMSDIGGETRLS LRIYGDGVEHKFPPILENIIQRIQTYFSVYRFTDTSKPGGLQRIELTTQP PDDSPDVTTAKAENDDELIAVGEQDAYITVGDDTD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23944-PA | 193 | GF23944-PA | 1..192 | 1..184 | 549 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13592-PA | 184 | GG13592-PA | 1..184 | 1..185 | 832 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16322-PA | 165 | GH16322-PA | 28..164 | 38..182 | 421 | 58.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13028-PA | 185 | CG13028-PA | 1..185 | 1..185 | 935 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13267-PA | 191 | GI13267-PA | 23..143 | 19..151 | 328 | 49.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20861-PA | 181 | GL20861-PA | 2..181 | 1..185 | 514 | 58.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28581-PA | 181 | GA28581-PA | 2..181 | 1..185 | 528 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25675-PA | 184 | GM25675-PA | 1..184 | 1..185 | 837 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14679-PA | 184 | GD14679-PA | 1..184 | 1..185 | 879 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12037-PA | 158 | GJ12037-PA | 37..135 | 44..149 | 308 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19273-PA | 191 | GK19273-PA | 1..188 | 1..182 | 407 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19889-PA | 184 | GE19889-PA | 1..184 | 1..185 | 840 | 87.6 | Plus |
Translation from 79 to 636
> IP20205.hyp MQFIYLTLALGLIFTTALQAAIIPLTLIKNGIEANSQALPTDTEKFGYLE FKPNGSLILRRAPNQSGSNLQDLVMLRGVLQALKASPSKMSDIGGETRLS LRIYGDGVEHKFPPILENIIQRIQTYFSVYRFTDTSKPGGLQRIELTTQP PDDSPDVTTAKAENDDELIAVGEQDAYITVGDDTD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13028-PA | 185 | CG13028-PA | 1..185 | 1..185 | 935 | 100 | Plus |