IP20206.complete Sequence
550 bp assembled on 2008-05-14
GenBank Submission: BT032710
> IP20206.complete
ATTAGGCTATACGAAGAAAGCATTTTTATGTCGCAAATGAGCGTAGTTAA
ACCATTTACATTCTGCAACTCAGAAACACTATAAGTGGCGTTTAGTTTAC
GTCTGGAACCTCTGTGTTCACTGAAGTCTTTCGGCCATGAAGTCCAAACA
AGTCTTTTACATCGCCTTCAGCTTGCTTCTGCTGGGATCCTTGCTGCCAA
ACGAAGTGGAGTCCTTAAGAGTAGATCTTAATAAGCTGGCGGAGTGCACA
GAATCGGGATTGAAAGTAGCCACAACGTTGCTCGTGAGGGCGATACCATG
TGTAAAAAAATTGGCAAAATGTGCTGACTTTCGAGCCATTAAGACTAAGG
ACCTTGATATTACCGCACTTGCCCTCTTGGGCTATCAATATCTGCAAACG
GTCGTGAACAACCAAAGATGTCTATTGATCTCATTGAAAGAAGGCTACGA
CGCTGTGTCGCCACACCTTGACAAACTTATTAGTGGCAAGTGCCTACCAG
GGCTCAGCTAAAGCAATATATACATATGCAAACAAAAAAAAAAAAAAAAA
IP20206.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:58:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14c.a | 538 | Acp53C14c.a | 1..534 | 1..534 | 2670 | 100 | Plus |
Acp53C14c-RA | 511 | Acp53C14c-RA | 1..511 | 23..533 | 2555 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:53:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 12637997..12638351 | 533..179 | 1775 | 100 | Minus |
chr2R | 21145070 | chr2R | 12638409..12638568 | 178..19 | 800 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:53:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16750780..16751135 | 534..179 | 1780 | 100 | Minus |
2R | 25286936 | 2R | 16751193..16751352 | 178..19 | 800 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 16751979..16752334 | 534..179 | 1780 | 100 | Minus |
2R | 25260384 | 2R | 16752392..16752551 | 178..19 | 800 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 20:53:54 has no hits.
IP20206.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:54:31 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 12637997..12638351 | 179..533 | 100 | <- | Minus |
chr2R | 12638409..12638566 | 21..178 | 100 | <- | Minus |
chr2R | 12638666..12638685 | 1..20 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:41 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:45 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RB | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:31:28 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:01 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:45 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:46 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:45 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..533 | 1..533 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:31:28 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..533 | 1..533 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:01 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 1..375 | 137..511 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:45 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14c-RA | 27..559 | 1..533 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16750781..16751135 | 179..533 | 100 | <- | Minus |
2R | 16751193..16751350 | 21..178 | 100 | <- | Minus |
2R | 16751450..16751469 | 1..20 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16750781..16751135 | 179..533 | 100 | <- | Minus |
2R | 16751193..16751350 | 21..178 | 100 | <- | Minus |
2R | 16751450..16751469 | 1..20 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16750781..16751135 | 179..533 | 100 | <- | Minus |
2R | 16751193..16751350 | 21..178 | 100 | <- | Minus |
2R | 16751450..16751469 | 1..20 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:31:28 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12638286..12638640 | 179..533 | 100 | <- | Minus |
arm_2R | 12638698..12638855 | 21..178 | 100 | <- | Minus |
arm_2R | 12638955..12638974 | 1..20 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:37 Download gff for
IP20206.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16751980..16752334 | 179..533 | 100 | <- | Minus |
2R | 16752392..16752549 | 21..178 | 100 | <- | Minus |
2R | 16752649..16752668 | 1..20 | 100 | | Minus |
IP20206.hyp Sequence
Translation from 136 to 510
> IP20206.hyp
MKSKQVFYIAFSLLLLGSLLPNEVESLRVDLNKLAECTESGLKVATTLLV
RAIPCVKKLAKCADFRAIKTKDLDITALALLGYQYLQTVVNNQRCLLISL
KEGYDAVSPHLDKLISGKCLPGLS*
IP20206.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:06:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14c-PB | 124 | CG33530-PB | 1..124 | 1..124 | 619 | 100 | Plus |
Acp53C14c-PA | 124 | CG33530-PA | 1..124 | 1..124 | 619 | 100 | Plus |
IP20206.pep Sequence
Translation from 136 to 510
> IP20206.pep
MKSKQVFYIAFSLLLLGSLLPNEVESLRVDLNKLAECTESGLKVATTLLV
RAIPCVKKLAKCADFRAIKTKDLDITALALLGYQYLQTVVNNQRCLLISL
KEGYDAVSPHLDKLISGKCLPGLS*
IP20206.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:30:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13448-PA | 333 | GF13448-PA | 1..99 | 1..102 | 162 | 38.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:30:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22245-PA | 125 | GG22245-PA | 1..120 | 1..120 | 401 | 69.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14c-PB | 124 | CG33530-PB | 1..124 | 1..124 | 619 | 100 | Plus |
Acp53C14c-PA | 124 | CG33530-PA | 1..124 | 1..124 | 619 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:30:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\Acp2-PA | 118 | GI20988-PA | 1..118 | 1..121 | 145 | 28.9 | Plus |
Dmoj\GI18622-PA | 118 | GI18622-PA | 1..118 | 1..121 | 144 | 28.9 | Plus |
Dmoj\GI20989-PA | 117 | GI20989-PA | 6..116 | 12..120 | 138 | 33.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:30:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11813-PA | 121 | GL11813-PA | 1..119 | 1..120 | 231 | 40.8 | Plus |
Dper\Acp53Ea-PA | 120 | GL11815-PA | 22..118 | 25..120 | 135 | 33.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:30:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\Acp53C14c-PA | 121 | GA25132-PA | 1..119 | 1..120 | 233 | 40.8 | Plus |
Dpse\Acp53Ea-PA | 120 | GA21214-PA | 22..118 | 25..120 | 135 | 33.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:30:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20033-PA | 124 | GM20033-PA | 1..124 | 1..124 | 504 | 86.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:30:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp53C14c-PA | 124 | GD25517-PA | 1..124 | 1..124 | 499 | 84.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:30:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19014-PA | 104 | GK19014-PA | 9..103 | 26..120 | 140 | 34.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:30:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14037-PA | 123 | GE14037-PA | 1..120 | 1..120 | 425 | 72.5 | Plus |