Clone IP20206 Report

Search the DGRC for IP20206

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:202
Well:6
Vector:pOT2
Associated Gene/TranscriptAcp53C14c-RA
Protein status:IP20206.pep: gold
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Acp53C14c 2008-05-05 Release 5.5 slip selected
Acp53C14c 2008-08-15 Release 5.9 accounting
Acp53C14c 2008-12-18 5.12 accounting

Clone Sequence Records

IP20206.complete Sequence

550 bp assembled on 2008-05-14

GenBank Submission: BT032710

> IP20206.complete
ATTAGGCTATACGAAGAAAGCATTTTTATGTCGCAAATGAGCGTAGTTAA
ACCATTTACATTCTGCAACTCAGAAACACTATAAGTGGCGTTTAGTTTAC
GTCTGGAACCTCTGTGTTCACTGAAGTCTTTCGGCCATGAAGTCCAAACA
AGTCTTTTACATCGCCTTCAGCTTGCTTCTGCTGGGATCCTTGCTGCCAA
ACGAAGTGGAGTCCTTAAGAGTAGATCTTAATAAGCTGGCGGAGTGCACA
GAATCGGGATTGAAAGTAGCCACAACGTTGCTCGTGAGGGCGATACCATG
TGTAAAAAAATTGGCAAAATGTGCTGACTTTCGAGCCATTAAGACTAAGG
ACCTTGATATTACCGCACTTGCCCTCTTGGGCTATCAATATCTGCAAACG
GTCGTGAACAACCAAAGATGTCTATTGATCTCATTGAAAGAAGGCTACGA
CGCTGTGTCGCCACACCTTGACAAACTTATTAGTGGCAAGTGCCTACCAG
GGCTCAGCTAAAGCAATATATACATATGCAAACAAAAAAAAAAAAAAAAA

IP20206.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c.a 538 Acp53C14c.a 1..534 1..534 2670 100 Plus
Acp53C14c-RA 511 Acp53C14c-RA 1..511 23..533 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12637997..12638351 533..179 1775 100 Minus
chr2R 21145070 chr2R 12638409..12638568 178..19 800 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:41:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16750780..16751135 534..179 1780 100 Minus
2R 25286936 2R 16751193..16751352 178..19 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16751979..16752334 534..179 1780 100 Minus
2R 25260384 2R 16752392..16752551 178..19 800 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:53:54 has no hits.

IP20206.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:54:31 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12637997..12638351 179..533 100 <- Minus
chr2R 12638409..12638566 21..178 100 <- Minus
chr2R 12638666..12638685 1..20 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:41 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:45 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RB 1..375 137..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:31:28 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:01 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:45 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:46 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:45 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..533 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:31:28 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..533 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:01 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 1..375 137..511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:45 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 27..559 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16750781..16751135 179..533 100 <- Minus
2R 16751193..16751350 21..178 100 <- Minus
2R 16751450..16751469 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16750781..16751135 179..533 100 <- Minus
2R 16751193..16751350 21..178 100 <- Minus
2R 16751450..16751469 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:54:31 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16750781..16751135 179..533 100 <- Minus
2R 16751193..16751350 21..178 100 <- Minus
2R 16751450..16751469 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:31:28 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12638286..12638640 179..533 100 <- Minus
arm_2R 12638698..12638855 21..178 100 <- Minus
arm_2R 12638955..12638974 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:37 Download gff for IP20206.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16751980..16752334 179..533 100 <- Minus
2R 16752392..16752549 21..178 100 <- Minus
2R 16752649..16752668 1..20 100   Minus

IP20206.hyp Sequence

Translation from 136 to 510

> IP20206.hyp
MKSKQVFYIAFSLLLLGSLLPNEVESLRVDLNKLAECTESGLKVATTLLV
RAIPCVKKLAKCADFRAIKTKDLDITALALLGYQYLQTVVNNQRCLLISL
KEGYDAVSPHLDKLISGKCLPGLS*

IP20206.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c-PB 124 CG33530-PB 1..124 1..124 619 100 Plus
Acp53C14c-PA 124 CG33530-PA 1..124 1..124 619 100 Plus

IP20206.pep Sequence

Translation from 136 to 510

> IP20206.pep
MKSKQVFYIAFSLLLLGSLLPNEVESLRVDLNKLAECTESGLKVATTLLV
RAIPCVKKLAKCADFRAIKTKDLDITALALLGYQYLQTVVNNQRCLLISL
KEGYDAVSPHLDKLISGKCLPGLS*

IP20206.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13448-PA 333 GF13448-PA 1..99 1..102 162 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22245-PA 125 GG22245-PA 1..120 1..120 401 69.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c-PB 124 CG33530-PB 1..124 1..124 619 100 Plus
Acp53C14c-PA 124 CG33530-PA 1..124 1..124 619 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Acp2-PA 118 GI20988-PA 1..118 1..121 145 28.9 Plus
Dmoj\GI18622-PA 118 GI18622-PA 1..118 1..121 144 28.9 Plus
Dmoj\GI20989-PA 117 GI20989-PA 6..116 12..120 138 33.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11813-PA 121 GL11813-PA 1..119 1..120 231 40.8 Plus
Dper\Acp53Ea-PA 120 GL11815-PA 22..118 25..120 135 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Acp53C14c-PA 121 GA25132-PA 1..119 1..120 233 40.8 Plus
Dpse\Acp53Ea-PA 120 GA21214-PA 22..118 25..120 135 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20033-PA 124 GM20033-PA 1..124 1..124 504 86.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp53C14c-PA 124 GD25517-PA 1..124 1..124 499 84.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19014-PA 104 GK19014-PA 9..103 26..120 140 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14037-PA 123 GE14037-PA 1..120 1..120 425 72.5 Plus