Clone IP20256 Report

Search the DGRC for IP20256

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:202
Well:56
Vector:pOT2
Associated Gene/TranscriptCG32457-RB
Protein status:IP20256.pep: gold
Sequenced Size:639

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32457 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP20256.complete Sequence

639 bp assembled on 2010-02-19

GenBank Submission: BT120357.1

> IP20256.complete
CAAACACTAAGTATACACTCGTTTGTGATGCGTCGCACTTGGGTCCTGTT
TTACTTATTCCTAATTGGGTTGGCATTGGTAAAGACCACACCGAAAGAAC
TTCACTCAGAATCGATTTTTGAAGATGACGTCGCTCTAAGGTCCAAGTCA
AGTAAAGCTGATGCTCTGCTTACAAAAACTACAACAAAAGCGTCAGCATC
AAATTTATTCTTTAAAGTCATTACAACAACCCGACCACCTGTGACAATCA
GGCGCGTTGTAGCCAAGTCAAAGGGTAAGGATCCAGAAAGAACTGACCTC
CACCGCAAGCACCTCACACATCACAAACATCACTCAAAAAACAAAAAAAA
GAATCCACATAATCGTGCCGAAGCGAATCGAAACAAGGATCATAGTCCCC
ATGATCCCCACAAAAACCTGAAAAGAAAGGCAGAGGCACTCCCTAAGTCA
AATCAGAATATAAATGGCACTACTTCTCTGGAAGCCAAGAGTACGTCTTT
AAAAGATGTACATAAGTGAACGTCAATTTCTTTGCGTCAATACCTACTAC
GTATCCCTGACCATATAAATGTAATGATGTAATGTATTGCCAACAAATAA
TAAATTAAACTAACTAAAAACAAAAAAAAAAAAAAAAAA

IP20256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-RB 621 CG32457-RB 1..621 1..621 3105 100 Plus
CG32457-RC 686 CG32457-RC 152..557 218..623 2030 100 Plus
CG32457-RC 686 CG32457-RC 1..151 1..151 755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22976562..22977182 1..621 3105 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22987642..22988264 1..623 3115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22980742..22981364 1..623 3115 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:42:37 has no hits.

IP20256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:43:15 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22976562..22977182 1..621 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:25 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..492 28..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:10 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..492 28..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:21 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..492 28..519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:25 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:10 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:21 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RB 1..621 1..621 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:43:15 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22988262 1..621 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:43:15 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22988262 1..621 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:43:15 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22988262 1..621 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:10 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22980742..22981362 1..621 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:30:50 Download gff for IP20256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22980742..22981362 1..621 100   Plus

IP20256.hyp Sequence

Translation from 0 to 518

> IP20256.hyp
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
SKADALLTKTTTKASASNLFFKVITTTRPPVTIRRVVAKSKGKDPERTDL
HRKHLTHHKHHSKNKKKNPHNRAEANRNKDHSPHDPHKNLKRKAEALPKS
NQNINGTTSLEAKSTSLKDVHK*

IP20256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-PB 163 CG32457-PB 1..163 10..172 846 100 Plus
CG32457-PC 141 CG32457-PC 1..141 10..172 708 85.9 Plus

IP20256.pep Sequence

Translation from 0 to 518

> IP20256.pep
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
SKADALLTKTTTKASASNLFFKVITTTRPPVTIRRVVAKSKGKDPERTDL
HRKHLTHHKHHSKNKKKNPHNRAEANRNKDHSPHDPHKNLKRKAEALPKS
NQNINGTTSLEAKSTSLKDVHK*

IP20256.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16658-PA 188 GG16658-PA 1..170 10..170 406 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-PB 163 CG32457-PB 1..163 10..172 846 100 Plus
CG32457-PC 141 CG32457-PC 1..141 10..172 708 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19495-PA 139 GM19495-PA 1..139 10..148 517 80.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17954-PA 131 GD17954-PA 1..129 10..138 520 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18121-PA 188 GE18121-PA 1..170 10..170 420 58.7 Plus