Clone IP20259 Report

Search the DGRC for IP20259

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:202
Well:59
Vector:pOT2
Associated Gene/TranscriptCG14488-RA
Protein status:IP20259.pep: gold
Sequenced Size:588

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14488 2008-05-05 Release 5.5 slip selected
CG14488 2008-08-15 Release 5.9 accounting
CG14488 2008-12-18 5.12 accounting

Clone Sequence Records

IP20259.complete Sequence

588 bp assembled on 2008-05-14

GenBank Submission: BT032715

> IP20259.complete
GCAAACGAATAAATTATTTACCTTAGTATTAGATCGAAAAAATATATAAA
TTTTGTTCTGCAATGGTTGATCGTGGAAATAATTTGGTACTCCCAGTGGG
CCCATGTTCAACGGAACTAACGGAATCTCAAGCGAGTTTTGCTCCACCCA
AAATTAAGAAAGTGCTCCCCACTAGAGCAAATCGCATGGAACAGTTTCTA
TGGCAGGAACTCTTTGCCGAATACAACCGACAGGCCTCCGCCCAAGTGGA
TTTGGGTGAGGATCGCACGGAGTACTACGACCAGTTCTGCAAGGATGTGC
CACCGAAAAACGAAGAGACCGAGGAAGTTCTGGTCAACAAGTATCCACTT
TACTGCACTACTGCCGTAACAGTATGGAATCACGAGGGAGATTTCACCAA
GACTTTCAAAAGAAAATATTCTATTACCAGACCTATAGATCTGTGTCCTG
ATAAGTTTGCACTTTAGATGTGGAAATTGTATGAGAGTAGTGCCCACAGA
ATATTATTTAATTTTGATCTTTCATTGTAAATGTTACATAAAAATTAAAC
TTGCAGTTTGAGAAATTCTAAAAAAAAAAAAAAAAAAA

IP20259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14488-RA 569 CG14488-RA 1..569 1..569 2845 100 Plus
CG6370.a 2337 CG6370.a 1..44 527..570 220 100 Plus
CG6370-RA 2374 CG6370-RA 1..44 527..570 220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13654301..13654701 569..169 1990 99.8 Minus
chr2R 21145070 chr2R 13654755..13654922 168..1 840 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17767164..17767565 570..169 2010 100 Minus
2R 25286936 2R 17767619..17767786 168..1 840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17768363..17768764 570..169 2010 100 Minus
2R 25260384 2R 17768818..17768985 168..1 840 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:24:33 has no hits.

IP20259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:25:46 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13654301..13654701 169..569 99 <- Minus
chr2R 13654755..13654922 1..168 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:55 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..405 63..467 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:12 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..405 63..467 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:47 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..405 63..467 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:25 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..405 63..467 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:33 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..405 63..467 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:07 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..541 29..569 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:12 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..541 29..569 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:47 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..569 1..569 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:25 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..541 29..569 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:33 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
CG14488-RA 1..569 1..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:46 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17767165..17767565 169..569 100 <- Minus
2R 17767619..17767786 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:46 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17767165..17767565 169..569 100 <- Minus
2R 17767619..17767786 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:46 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17767165..17767565 169..569 100 <- Minus
2R 17767619..17767786 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:47 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13654670..13655070 169..569 100 <- Minus
arm_2R 13655124..13655291 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:12 Download gff for IP20259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17768818..17768985 1..168 100   Minus
2R 17768364..17768764 169..569 100 <- Minus

IP20259.pep Sequence

Translation from 62 to 466

> IP20259.pep
MVDRGNNLVLPVGPCSTELTESQASFAPPKIKKVLPTRANRMEQFLWQEL
FAEYNRQASAQVDLGEDRTEYYDQFCKDVPPKNEETEEVLVNKYPLYCTT
AVTVWNHEGDFTKTFKRKYSITRPIDLCPDKFAL*

IP20259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13224-PA 134 GF13224-PA 1..134 1..134 587 79.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21019-PA 134 GG21019-PA 1..134 1..134 692 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19851-PA 134 GH19851-PA 13..133 13..133 435 65.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14488-PA 134 CG14488-PA 1..134 1..134 722 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20442-PA 134 GI20442-PA 13..133 13..133 389 59.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17275-PA 134 GL17275-PA 1..133 1..133 483 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24159-PA 134 GA24159-PA 13..133 13..133 481 71.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19950-PA 134 GM19950-PA 1..134 1..134 713 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25441-PA 134 GD25441-PA 1..134 1..134 719 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20112-PA 134 GJ20112-PA 1..133 2..133 429 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23309-PA 135 GK23309-PA 14..134 13..133 476 68.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13962-PA 134 GE13962-PA 1..134 1..134 688 95.5 Plus

IP20259.hyp Sequence

Translation from 62 to 466

> IP20259.hyp
MVDRGNNLVLPVGPCSTELTESQASFAPPKIKKVLPTRANRMEQFLWQEL
FAEYNRQASAQVDLGEDRTEYYDQFCKDVPPKNEETEEVLVNKYPLYCTT
AVTVWNHEGDFTKTFKRKYSITRPIDLCPDKFAL*

IP20259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG14488-PA 134 CG14488-PA 1..134 1..134 722 100 Plus