BDGP Sequence Production Resources |
Search the DGRC for IP20266
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 202 |
Well: | 66 |
Vector: | pOT2 |
Associated Gene/Transcript | Ilp5-RA |
Protein status: | IP20266.pep: gold |
Sequenced Size: | 485 |
Gene | Date | Evidence |
---|---|---|
Ilp5 | 2008-05-05 | Release 5.5 slip selected |
Ilp5 | 2008-08-15 | Release 5.9 accounting |
Ilp5 | 2008-12-18 | 5.12 accounting |
485 bp assembled on 2008-05-14
GenBank Submission: BT032927
> IP20266.complete AGCAAGGCAATGATGTTCCGCTCCGTGATCCCAGTTCTCCTGTTCCTGAT CCCGCTCCTGCTATCCGCCCAGGCCGCAAACTCGCTGCGGGCTTGTGGCC CCGCCTTGATGGACATGCTGAGGGTTGCCTGTCCCAATGGATTCAATTCA ATGTTCGCCAAACGAGGCACCTTGGGCCTATTCGATTATGAGGACCACTT GGCGGATTTGGATAGCTCCGAATCTCACCACATGAACTCACTGTCGAGCA TTCGGCGCGATTTTCGCGGCGTTGTCGACTCCTGTTGCCGCAAATCGTGT TCCTTTTCCACGTTGAGGGCATACTGCGACTCCTAAAAATGCTGCGATAC CTGGTCCATCAGTTTACATACATACATATATGAGACATGTTACGTAAAAG TATTAAGTATAAACTATATGCACGGCTTTGAAACTTGAAACTACAATAAA TAAGCGCAATTCGAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 9815147..9815437 | 173..463 | 100 | <- | Minus |
chr3L | 9815509..9815680 | 1..172 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 16..478 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 16..478 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 1..324 | 13..336 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp5-RA | 16..478 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9823349..9823639 | 173..463 | 100 | <- | Minus |
3L | 9823711..9823882 | 1..172 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9823349..9823639 | 173..463 | 100 | <- | Minus |
3L | 9823711..9823882 | 1..172 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9823349..9823639 | 173..463 | 100 | <- | Minus |
3L | 9823711..9823882 | 1..172 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 9816449..9816739 | 173..463 | 100 | <- | Minus |
arm_3L | 9816811..9816982 | 1..172 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9816449..9816739 | 173..463 | 100 | <- | Minus |
3L | 9816811..9816982 | 1..172 | 100 | Minus |
Translation from 0 to 335
> IP20266.hyp SKAMMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNS MFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSC SFSTLRAYCDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ilp5-PA | 107 | CG33273-PA | 1..107 | 5..111 | 557 | 100 | Plus |
Translation from 0 to 335
> IP20266.pep SKAMMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNS MFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSC SFSTLRAYCDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20100-PA | 111 | GF20100-PA | 5..110 | 9..109 | 137 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14004-PA | 109 | GG14004-PA | 1..107 | 5..109 | 379 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16013-PA | 125 | GH16013-PA | 26..123 | 22..109 | 168 | 39.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ilp5-PB | 108 | CG33273-PB | 1..108 | 4..111 | 562 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16323-PA | 136 | GL16323-PA | 33..135 | 28..109 | 160 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23860-PA | 136 | GA23860-PA | 33..135 | 28..109 | 160 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24838-PA | 107 | GM24838-PA | 1..107 | 5..111 | 538 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12890-PA | 107 | GD12890-PA | 1..107 | 5..111 | 537 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13215-PA | 121 | GJ13215-PA | 20..119 | 20..109 | 170 | 40 | Plus |
Dvir\GJ12130-PA | 135 | GJ12130-PA | 6..133 | 8..109 | 134 | 30.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20299-PA | 106 | GE20299-PA | 1..106 | 5..111 | 373 | 76.6 | Plus |