Clone IP20266 Report

Search the DGRC for IP20266

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:202
Well:66
Vector:pOT2
Associated Gene/TranscriptIlp5-RA
Protein status:IP20266.pep: gold
Sequenced Size:485

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ilp5 2008-05-05 Release 5.5 slip selected
Ilp5 2008-08-15 Release 5.9 accounting
Ilp5 2008-12-18 5.12 accounting

Clone Sequence Records

IP20266.complete Sequence

485 bp assembled on 2008-05-14

GenBank Submission: BT032927

> IP20266.complete
AGCAAGGCAATGATGTTCCGCTCCGTGATCCCAGTTCTCCTGTTCCTGAT
CCCGCTCCTGCTATCCGCCCAGGCCGCAAACTCGCTGCGGGCTTGTGGCC
CCGCCTTGATGGACATGCTGAGGGTTGCCTGTCCCAATGGATTCAATTCA
ATGTTCGCCAAACGAGGCACCTTGGGCCTATTCGATTATGAGGACCACTT
GGCGGATTTGGATAGCTCCGAATCTCACCACATGAACTCACTGTCGAGCA
TTCGGCGCGATTTTCGCGGCGTTGTCGACTCCTGTTGCCGCAAATCGTGT
TCCTTTTCCACGTTGAGGGCATACTGCGACTCCTAAAAATGCTGCGATAC
CTGGTCCATCAGTTTACATACATACATATATGAGACATGTTACGTAAAAG
TATTAAGTATAAACTATATGCACGGCTTTGAAACTTGAAACTACAATAAA
TAAGCGCAATTCGAAAAAAAAAAAAAAAAAAAAAA

IP20266.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-RA 644 Ilp5-RA 178..643 1..466 2330 100 Plus
Ilp5.a 644 Ilp5.a 178..643 1..466 2330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9815147..9815437 463..173 1455 100 Minus
chr3L 24539361 chr3L 9815509..9815680 172..1 845 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9823346..9823639 466..173 1470 100 Minus
3L 28110227 3L 9823711..9823882 172..1 860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9816446..9816739 466..173 1470 100 Minus
3L 28103327 3L 9816811..9816982 172..1 860 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:57:56 has no hits.

IP20266.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:58:41 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9815147..9815437 173..463 100 <- Minus
chr3L 9815509..9815680 1..172 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:19:59 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:55:24 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:03 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:57 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:49 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:05 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:55:24 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 16..478 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:03 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 16..478 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:58 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..324 13..336 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:49 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 16..478 1..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:41 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9823349..9823639 173..463 100 <- Minus
3L 9823711..9823882 1..172 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:41 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9823349..9823639 173..463 100 <- Minus
3L 9823711..9823882 1..172 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:41 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9823349..9823639 173..463 100 <- Minus
3L 9823711..9823882 1..172 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:03 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9816449..9816739 173..463 100 <- Minus
arm_3L 9816811..9816982 1..172 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:32:26 Download gff for IP20266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9816449..9816739 173..463 100 <- Minus
3L 9816811..9816982 1..172 100   Minus

IP20266.hyp Sequence

Translation from 0 to 335

> IP20266.hyp
SKAMMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNS
MFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSC
SFSTLRAYCDS*

IP20266.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-PA 107 CG33273-PA 1..107 5..111 557 100 Plus

IP20266.pep Sequence

Translation from 0 to 335

> IP20266.pep
SKAMMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNS
MFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSC
SFSTLRAYCDS*

IP20266.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20100-PA 111 GF20100-PA 5..110 9..109 137 36.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14004-PA 109 GG14004-PA 1..107 5..109 379 80.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16013-PA 125 GH16013-PA 26..123 22..109 168 39.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-PB 108 CG33273-PB 1..108 4..111 562 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16323-PA 136 GL16323-PA 33..135 28..109 160 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23860-PA 136 GA23860-PA 33..135 28..109 160 36.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24838-PA 107 GM24838-PA 1..107 5..111 538 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12890-PA 107 GD12890-PA 1..107 5..111 537 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13215-PA 121 GJ13215-PA 20..119 20..109 170 40 Plus
Dvir\GJ12130-PA 135 GJ12130-PA 6..133 8..109 134 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20299-PA 106 GE20299-PA 1..106 5..111 373 76.6 Plus