Clone IP20271 Report

Search the DGRC for IP20271

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:202
Well:71
Vector:pOT2
Protein status:IP20271.pep: Imported from assembly
Sequenced Size:373

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
BG642167 2008-05-05 Release 5.5 slip selected
BG642167 2008-08-15 Release 5.9 accounting
BG642167 2008-12-18 5.12 accounting

Clone Sequence Records

IP20271.complete Sequence

373 bp assembled on 2008-05-22

GenBank Submission: BT032716

> IP20271.complete
TTAGCTGTATTGACTTTTCTAGTACTCTGTGGATTTTCCTTTCAGCATCA
GGCAGTTGCTGACTGCGGCGCAGAAACATCCGATCTCTGGAAGGATGATA
CGGATTCGGACGAAGGAACTTGCACTCAAGCCTCGATAAATAATGATAGG
AAGGAAGATCCATTTGAAAATGATCCAATTATAAGGCAATCGAAAAAGAA
AGTGGAAAACAATGACAGCATGAATTCAGAAGTTCAGTTGCCACTATTTC
AGAATATAATAAAGATATTCAAGTTTATATGGCTGGTGCTGAGTGTTTGG
ATGAATTGGAAGTAATAAAGGCGATAGGGCATATCTGCTCACAGATCCTG
CAAATTAAAAAAAAAAAAAAAAA

IP20271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-RA 383 BG642167-RA 24..382 1..359 1795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21629644..21629942 58..356 1495 100 Plus
chr3R 27901430 chr3R 21629451..21629508 1..58 290 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25806663..25806964 58..359 1510 100 Plus
3R 32079331 3R 25806473..25806530 1..58 290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25547494..25547795 58..359 1510 100 Plus
3R 31820162 3R 25547304..25547361 1..58 290 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:16:03 has no hits.

IP20271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:16:57 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21629451..21629508 1..58 100 -> Plus
chr3R 21629645..21629942 59..356 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:00 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:37:55 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:35:07 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:41 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:17:14 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:06 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:37:54 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..362 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:35:07 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..362 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:43:41 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 7..321 1..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:14 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 29..384 1..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25806473..25806530 1..58 100 -> Plus
3R 25806664..25806961 59..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25806473..25806530 1..58 100 -> Plus
3R 25806664..25806961 59..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25806473..25806530 1..58 100 -> Plus
3R 25806664..25806961 59..356 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:35:07 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21632195..21632252 1..58 100 -> Plus
arm_3R 21632386..21632683 59..356 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:43 Download gff for IP20271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25547495..25547792 59..356 100   Plus
3R 25547304..25547361 1..58 100 -> Plus

IP20271.pep Sequence

Translation from 0 to 314

> IP20271.pep
LAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINNDR
KEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLSVW
MNWK*

IP20271.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-PA 106 CG34103-PA 3..106 1..104 557 100 Plus

IP20271.hyp Sequence

Translation from 0 to 314

> IP20271.hyp
LAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINNDR
KEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLSVW
MNWK*

IP20271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-PA 106 CG34103-PA 3..106 1..104 557 100 Plus