IP20271.complete Sequence
373 bp assembled on 2008-05-22
GenBank Submission: BT032716
> IP20271.complete
TTAGCTGTATTGACTTTTCTAGTACTCTGTGGATTTTCCTTTCAGCATCA
GGCAGTTGCTGACTGCGGCGCAGAAACATCCGATCTCTGGAAGGATGATA
CGGATTCGGACGAAGGAACTTGCACTCAAGCCTCGATAAATAATGATAGG
AAGGAAGATCCATTTGAAAATGATCCAATTATAAGGCAATCGAAAAAGAA
AGTGGAAAACAATGACAGCATGAATTCAGAAGTTCAGTTGCCACTATTTC
AGAATATAATAAAGATATTCAAGTTTATATGGCTGGTGCTGAGTGTTTGG
ATGAATTGGAAGTAATAAAGGCGATAGGGCATATCTGCTCACAGATCCTG
CAAATTAAAAAAAAAAAAAAAAA
IP20271.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:51:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642167-RA | 383 | BG642167-RA | 24..382 | 1..359 | 1795 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:16:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 21629644..21629942 | 58..356 | 1495 | 100 | Plus |
chr3R | 27901430 | chr3R | 21629451..21629508 | 1..58 | 290 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25806663..25806964 | 58..359 | 1510 | 100 | Plus |
3R | 32079331 | 3R | 25806473..25806530 | 1..58 | 290 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 25547494..25547795 | 58..359 | 1510 | 100 | Plus |
3R | 31820162 | 3R | 25547304..25547361 | 1..58 | 290 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-17 00:16:03 has no hits.
IP20271.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:16:57 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 21629451..21629508 | 1..58 | 100 | -> | Plus |
chr3R | 21629645..21629942 | 59..356 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:00 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:37:55 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:35:07 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:41 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:17:14 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:06 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:37:54 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..362 | 1..356 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:35:07 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..362 | 1..356 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:43:41 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 7..321 | 1..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:14 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BG642167-RA | 29..384 | 1..356 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25806473..25806530 | 1..58 | 100 | -> | Plus |
3R | 25806664..25806961 | 59..356 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25806473..25806530 | 1..58 | 100 | -> | Plus |
3R | 25806664..25806961 | 59..356 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:57 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25806473..25806530 | 1..58 | 100 | -> | Plus |
3R | 25806664..25806961 | 59..356 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:35:07 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21632195..21632252 | 1..58 | 100 | -> | Plus |
arm_3R | 21632386..21632683 | 59..356 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:43 Download gff for
IP20271.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25547495..25547792 | 59..356 | 100 | | Plus |
3R | 25547304..25547361 | 1..58 | 100 | -> | Plus |
IP20271.pep Sequence
Translation from 0 to 314
> IP20271.pep
LAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINNDR
KEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLSVW
MNWK*
IP20271.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642167-PA | 106 | CG34103-PA | 3..106 | 1..104 | 557 | 100 | Plus |
IP20271.hyp Sequence
Translation from 0 to 314
> IP20271.hyp
LAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINNDR
KEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLSVW
MNWK*
IP20271.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BG642167-PA | 106 | CG34103-PA | 3..106 | 1..104 | 557 | 100 | Plus |