Clone IP20302 Report

Search the DGRC for IP20302

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:203
Well:2
Vector:pOT2
Associated Gene/TranscriptCG15719-RC
Protein status:IP20302.pep: gold
Sequenced Size:818

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15719 2008-12-03 Manual selection by Sue Celniker

Clone Sequence Records

IP20302.complete Sequence

818 bp assembled on 2010-02-11

> IP20302.complete
AGAGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTATAAGTCAACCACATTTGTTGGGAACAATTGTCGGACAGGGGGAGCAG
AGACTCAAAAAGCGTATATCAAAATGGCACCCAATCGCAAGGACGGAAAG
AAGAATATTACGGAAAAGCAGGAAGCGAAAATGTTAGCCGAAGCTGGTGG
AAAATCGGCCAGTGATAGCGATGCGAGCGATACCGAATGGCAAATGGTTC
AATTTGTGGACGATCCGAATGTCCTGCGAGTTGCGATCATAGCTTGTCCT
GAGGTGACCTTGGGCTTTTTACTGTGTGGCGTTGGCTATCAGAAGGATAG
ATTTCGCAACTATATGATGGTTGAGAGCGAGACGCCACAAGAGGATGTGG
AGCAGTTCTTTCTCACGGTTTACAGGAGATCCAATATCGGCATTGTCATC
ATCGACTACGATACGGTGAAAAGGCTTCGTACCATGATGCAACGATGTTC
TCAGCTGCTTCCCGTCCTGGTCACGGTGCCCAACAAATCCTCACTGATCA
CGTACTTGGACAAAAAGGAGCGAAATCGGCGACTTCGCCAGCGTGATGCC
TATTAGGATTTCGATTTGGAAGTGGTTTTTTTTATTTTTTACCTCCCCCT
GTTACTGTGACAAATTCGAAGCACGAAAACAGGTCAAATCATTTTCGTTT
TATAAATTTGGGATATCTTAACTATCAAACGACAATCGACTTGATACATT
TAGACAATGAGCTTGAATAATGGATGTATCAATAAAGCCCATTCCAATTT
CAAAAAAAAAAAAAAAAA

IP20302.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15719-RB 792 CG15719-RB 74..792 85..803 3595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12894926..12895348 801..379 2115 100 Minus
chrX 22417052 chrX 12895538..12895754 301..85 1085 100 Minus
chrX 22417052 chrX 12895401..12895479 379..301 380 98.7 Minus
chrX 22417052 chrX 12895820..12895862 84..42 200 97.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13003953..13004377 803..379 2125 100 Minus
X 23542271 X 13004567..13004783 301..85 1085 100 Minus
X 23542271 X 13004430..13004508 379..301 395 100 Minus
X 23542271 X 13004850..13004892 84..42 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13012051..13012475 803..379 2125 100 Minus
X 23527363 X 13012665..13012881 301..85 1085 100 Minus
X 23527363 X 13012528..13012606 379..301 395 100 Minus
X 23527363 X 13012948..13012990 84..42 215 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:30:03 has no hits.

IP20302.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:30:55 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12894926..12895347 380..801 100 <- Minus
chrX 12895401..12895479 301..379 98 <- Minus
chrX 12895539..12895754 85..300 100 <- Minus
chrX 12895820..12895851 53..84 100 -- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 10:11:28 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RB 1..483 124..606 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:27 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RB 1..483 124..606 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:06 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RC 1..483 124..606 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:04 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RC 1..483 124..606 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 10:11:27 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RB 1..678 124..801 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:27 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RB 1..678 124..801 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:06 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RD 1..747 55..801 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:04 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
CG15719-RD 1..747 55..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:55 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
X 13003955..13004376 380..801 100 <- Minus
X 13004430..13004508 301..379 100 <- Minus
X 13004568..13004783 85..300 100 <- Minus
X 13004850..13004881 53..84 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:55 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
X 13003955..13004376 380..801 100 <- Minus
X 13004430..13004508 301..379 100 <- Minus
X 13004568..13004783 85..300 100 <- Minus
X 13004850..13004881 53..84 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:55 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
X 13003955..13004376 380..801 100 <- Minus
X 13004430..13004508 301..379 100 <- Minus
X 13004568..13004783 85..300 100 <- Minus
X 13004850..13004881 53..84 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:06 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12897988..12898409 380..801 100 <- Minus
arm_X 12898463..12898541 301..379 100 <- Minus
arm_X 12898601..12898816 85..300 100 <- Minus
arm_X 12898883..12898914 53..84 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:59 Download gff for IP20302.complete
Subject Subject Range Query Range Percent Splice Strand
X 13012053..13012474 380..801 100 <- Minus
X 13012528..13012606 301..379 100 <- Minus
X 13012666..13012881 85..300 100 <- Minus
X 13012948..13012979 53..84 100 <- Minus

IP20302.pep Sequence

Translation from 0 to 605

> IP20302.pep
RELVSSFFFFFFFFFFFYKSTTFVGNNCRTGGAETQKAYIKMAPNRKDGK
KNITEKQEAKMLAEAGGKSASDSDASDTEWQMVQFVDDPNVLRVAIIACP
EVTLGFLLCGVGYQKDRFRNYMMVESETPQEDVEQFFLTVYRRSNIGIVI
IDYDTVKRLRTMMQRCSQLLPVLVTVPNKSSLITYLDKKERNRRLRQRDA
Y*

IP20302.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20878-PA 177 GF20878-PA 43..177 69..201 426 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19527-PA 160 GG19527-PA 1..160 42..201 670 83.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24550-PA 146 GH24550-PA 11..145 69..201 294 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15719-PD 160 CG15719-PD 1..160 42..201 820 100 Plus
CG15719-PC 160 CG15719-PC 1..160 42..201 820 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16267-PA 146 GI16267-PA 30..133 87..190 287 47.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22955-PA 154 GL22955-PA 42..153 87..199 317 50.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13911-PA 154 GA13911-PA 42..153 87..199 317 50.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11520-PA 135 GM11520-PA 1..135 42..201 668 82.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15910-PA 115 GD15910-PA 1..111 42..177 496 72.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16910-PA 146 GJ16910-PA 32..145 88..201 320 51.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25730-PA 170 GK25730-PA 54..169 86..201 388 53.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16185-PA 135 GE16185-PA 1..135 42..201 562 69.4 Plus

IP20302.hyp Sequence

Translation from 54 to 605

> IP20302.hyp
KSTTFVGNNCRTGGAETQKAYIKMAPNRKDGKKNITEKQEAKMLAEAGGK
SASDSDASDTEWQMVQFVDDPNVLRVAIIACPEVTLGFLLCGVGYQKDRF
RNYMMVESETPQEDVEQFFLTVYRRSNIGIVIIDYDTVKRLRTMMQRCSQ
LLPVLVTVPNKSSLITYLDKKERNRRLRQRDAY*

IP20302.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15719-PD 160 CG15719-PD 1..160 24..183 820 100 Plus
CG15719-PC 160 CG15719-PC 1..160 24..183 820 100 Plus