Clone IP20312 Report

Search the DGRC for IP20312

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:203
Well:12
Vector:pOT2
Associated Gene/Transcriptrev7-RA
Protein status:IP20312.pep: gold
Sequenced Size:858

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
rev7 2008-05-05 Release 5.5 slip selected
rev7 2008-08-15 Release 5.9 accounting
rev7 2008-12-18 5.12 accounting

Clone Sequence Records

IP20312.complete Sequence

858 bp assembled on 2008-05-29

GenBank Submission: BT033058

> IP20312.complete
CCCTAATGAACGGAGCTTAAATCTAAAAAATAAACAATCATCTGTGAACT
TAGTTGCGCTTGCTTGCGAAATGCAGGCGGAGATTAAGGCCGACATCATC
GTGGAGGCGATGGAGGTGCTAGTGAATCACATTCTATACGTGCGCGGTAT
ATACCCCTCGCACATTTTTAAAATGAAGCGGATGTACAACTCGCCCATCT
ATGTGTCCATATTTCCACCGCTTAATAACTACCTGGCCGGCGTCCTAAAA
TCCGCACAAGAACTTCTTCGCCGCCGGGAGCTGCAGTGCCTGGAGCTAAT
AGTGTATCAGAAGGAGAATGAGAAGTTGGAGAGCTATAAAATGCAACTAG
AAACCCAGAGGAGTGGCCTACCGGCAGAGGATCATTTGATGGAGTTCGAG
CAGAACATGCGCTCTGTCATCTACAAAATCTCTCAGCGCTTAAACCAGGC
GCCTAAACTGCCCGCCGGAAGTTGTCAGTTTAAGGTGCATCTGCACACTA
CCCAGGAGGCATTCATCCGCTTCAGCCATGACTCCCAGTACCAGGAGTTT
CCCTGGCTTCAGACCCAAAAAACTGAATCCCAAGCGACAGGGCGAACCGT
TTACCTCCTTCCTTTGGCTAGGGTAGATGATTTGGGACTGAAAATGGATG
TCCTCATCGTTAATTAATGTTATATTCCTAAAACTGTTATCCATTTTATC
GAAAACTACACGACGTTGGGTTTATTTTAAACTACAATTGATTCTAATCA
TGAATCGTTGGCTGATCCATGGTCTTTCTTTAATGAATAAAAGGACGCCC
AATGGTTTTATGGCTTAACATTAGATTCCTTAAAAAAAAAAAAAAAAAAA
AAAAAAAA

IP20312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
rev7-RA 597 rev7-RA 1..597 71..667 2985 100 Plus
noi-RA 1864 noi-RA 1748..1864 839..723 570 99.1 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1414532..1415362 1..831 4155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5588873..5589711 1..839 4180 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5329704..5330542 1..839 4180 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 11:03:51 has no hits.

IP20312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:04:51 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1414532..1415362 1..831 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:12 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:13 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:19:53 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:19 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:49 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:20:54 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:13 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:19:53 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:51:19 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..597 71..667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:49 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
rev7-RA 1..831 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:51 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5588873..5589703 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:51 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5588873..5589703 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:51 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5588873..5589703 1..831 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:19:53 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1414595..1415425 1..831 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:54 Download gff for IP20312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5329704..5330534 1..831 100   Plus

IP20312.hyp Sequence

Translation from 0 to 666

> IP20312.hyp
PNERSLNLKNKQSSVNLVALACEMQAEIKADIIVEAMEVLVNHILYVRGI
YPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRRELQCLELI
VYQKENEKLESYKMQLETQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQA
PKLPAGSCQFKVHLHTTQEAFIRFSHDSQYQEFPWLQTQKTESQATGRTV
YLLPLARVDDLGLKMDVLIVN*

IP20312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
rev7-PA 198 CG2948-PA 1..198 24..221 1014 100 Plus

IP20312.pep Sequence

Translation from 1 to 666

> IP20312.pep
PNERSLNLKNKQSSVNLVALACEMQAEIKADIIVEAMEVLVNHILYVRGI
YPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRRELQCLELI
VYQKENEKLESYKMQLETQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQA
PKLPAGSCQFKVHLHTTQEAFIRFSHDSQYQEFPWLQTQKTESQATGRTV
YLLPLARVDDLGLKMDVLIVN*

IP20312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20698-PA 202 GF20698-PA 1..199 24..219 637 59.3 Plus
Dana\GF10441-PA 207 GF10441-PA 17..163 30..168 154 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12925-PA 198 GG12925-PA 1..198 24..221 893 84.3 Plus
Dere\GG14107-PA 207 GG14107-PA 17..163 30..168 146 28.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14659-PA 202 GH14659-PA 1..200 24..219 473 46.8 Plus
Dgri\GH17035-PA 207 GH17035-PA 17..165 30..170 150 28.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
rev7-PA 198 CG2948-PA 1..198 24..221 1014 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23673-PA 198 GI23673-PA 1..198 24..221 488 45.7 Plus
Dmoj\GI12039-PA 209 GI12039-PA 17..169 30..172 158 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22309-PA 198 GL22309-PA 9..198 36..221 591 58.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15539-PA 202 GA15539-PA 1..202 24..221 623 58.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10817-PA 198 GM10817-PA 1..198 24..221 985 93.4 Plus
Dsec\GM15456-PA 198 GM15456-PA 1..198 24..221 985 93.4 Plus
Dsec\GM13893-PA 207 GM13893-PA 17..163 30..168 145 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19796-PA 198 GD19796-PA 1..198 24..221 981 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23233-PA 198 GJ23233-PA 1..196 24..219 496 47.7 Plus
Dvir\GJ13309-PA 207 GJ13309-PA 17..167 30..172 151 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22510-PA 202 GK22510-PA 2..202 23..221 529 50.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10140-PA 198 GE10140-PA 1..197 24..220 889 82.7 Plus
Dyak\GE20532-PA 207 GE20532-PA 17..163 30..168 144 28.4 Plus