Clone IP20317 Report

Gene	Date	Evidence
CG32213	2008-05-05	Release 5.5 slip selected
825-Oak	2008-08-15	Release 5.9 accounting
825-Oak	2008-12-18	5.12 accounting

Clone Sequence Records

IP20317.complete Sequence

511 bp assembled on 2008-05-14

GenBank Submission: BT032721

> IP20317.complete
CGAAGAAGCAAACCAAACAAATATTTCACCATGTTCAAATACGCTGTCGT
CGTTCTCGCTCTCGTTGCCTGCGCTGCTGCCAAGCCTGGACTCCTGGGTG
CTCCCCTTGCTTACACTGCTCCTCTGGCTTACTCTGCTCCTGCTGCCGTG
GTAGCTGCTCCCGCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGC
CAGGAATTACAATGGAATCGCCTCTGCTCCTGTGATTGCTCCCGTTGCTG
CTCCTCTGGCTGCTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCT
GCTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGC
CTACTCCTCGCCTTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTC
CTGCACCATTTCTCATCTAAATTTTTATGCTGTGATTATCTAGGACGATA
AATATAATAAAAAGGAACGCTTATATCGATTTTATGACCTCACAAAAAAA
AAAAAAAAAAA

IP20317.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:37

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG32213-RB	575	CG32213-RB	71..566	1..496	2420	99.1	Plus
CG32213.a	509	CG32213.a	5..500	1..496	2420	99.1	Plus
825-Oak-RB	489	825-Oak-RB	27..489	1..463	2285	99.5	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:21:51

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr3L	24539361	chr3L	19461079..19461529	493..43	2225	99.6	Minus
chr3L	24539361	chr3L	19465384..19465830	43..489	2190	99.3	Plus
chr3L	24539361	chr3L	19456893..19457152	43..302	1270	99.2	Plus
chr3L	24539361	chr3L	19462043..19462432	53..436	1100	86.1	Plus
chr3L	24539361	chr3L	19464576..19464870	341..53	745	84.4	Minus
chr3L	24539361	chr3L	19456150..19456374	259..53	715	88.9	Minus
chr3L	24539361	chr3L	19457097..19457247	286..436	560	91.4	Plus
chr3L	24539361	chr3L	19413331..19413469	102..240	485	89.9	Plus
chr3L	24539361	chr3L	19467855..19467993	102..240	470	89.2	Plus
chr3L	24539361	chr3L	19412531..19412723	261..68	320	78.9	Minus
chr3L	24539361	chr3L	19476218..19476368	436..285	290	80.9	Minus
chr3L	24539361	chr3L	19477480..19477558	63..141	290	91.1	Plus
chr3L	24539361	chr3L	19467076..19467183	436..329	285	84.3	Minus
chr3L	24539361	chr3L	19477537..19477680	102..254	280	80.4	Plus
chr3L	24539361	chr3L	19414163..19414242	155..234	265	88.8	Plus
chr3L	24539361	chr3L	19461231..19461286	302..247	265	98.2	Minus
chr3L	24539361	chr3L	19461270..19461325	341..286	265	98.2	Minus
chr3L	24539361	chr3L	19465588..19465643	286..341	265	98.2	Plus
chr3L	24539361	chr3L	19465627..19465682	247..302	265	98.2	Plus
chr3L	24539361	chr3L	19412429..19412527	392..293	255	86	Minus
chr3L	24539361	chr3L	19464546..19464632	332..246	255	86.2	Minus
chr3L	24539361	chr3L	19462281..19462337	246..302	240	94.7	Plus
chr3L	24539361	chr3L	19476312..19476403	302..211	235	83.7	Minus
chr3L	24539361	chr3L	19413153..19413195	1..43	215	100	Plus
chr3L	24539361	chr3L	19456792..19456834	1..43	215	100	Plus
chr3L	24539361	chr3L	19461588..19461630	43..1	215	100	Minus
chr3L	24539361	chr3L	19465283..19465325	1..43	215	100	Plus
chr3L	24539361	chr3L	19413274..19413329	63..118	190	89.3	Plus
chr3L	24539361	chr3L	19467798..19467853	63..118	190	89.3	Plus

Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:42:18

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CR32205-RA	1085	CR32205-RA	140..278	240..102	485	89.9	Minus
CR32205-RA	1085	CR32205-RA	699..817	143..261	310	84	Plus
CR32205-RA	1085	CR32205-RA	257..335	141..63	290	91.1	Minus
pncr009:3L-RA	961	CR33940-RA	266..344	141..63	275	89.8	Minus
pncr009:3L-RA	961	CR33940-RA	807..924	318..436	270	83.1	Plus
CR32205-RA	1085	CR32205-RA	821..919	293..392	265	86	Plus
pncr009:3L-RA	961	CR33940-RA	202..287	187..102	235	84.8	Minus
pncr009:3L-RA	961	CR33940-RA	739..790	211..262	185	90.3	Plus
pncr009:3L-RA	961	CR33940-RA	144..203	254..195	180	86.6	Minus

Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:21:49

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28110227	3L	19471652..19472106	497..43	2245	99.6	Minus
3L	28110227	3L	19475961..19476414	43..496	2210	99.1	Plus
3L	28110227	3L	19467471..19467730	43..302	1270	99.2	Plus
3L	28110227	3L	19472620..19473009	53..436	1085	85.8	Plus
3L	28110227	3L	19475153..19475447	341..53	745	84.4	Minus
3L	28110227	3L	19466728..19466952	259..53	685	88	Minus
3L	28110227	3L	19467675..19467825	286..436	545	90.7	Plus
3L	28110227	3L	19423906..19424044	102..240	485	89.9	Plus
3L	28110227	3L	19478430..19478568	102..240	485	89.9	Plus
3L	28110227	3L	19423106..19423298	261..68	320	78.9	Minus
3L	28110227	3L	19477653..19477760	436..329	300	85.2	Minus
3L	28110227	3L	19488102..19488245	102..254	280	80.4	Plus
3L	28110227	3L	19486783..19486933	436..285	275	80.3	Minus
3L	28110227	3L	19488045..19488123	63..141	275	89.9	Plus
3L	28110227	3L	19424757..19424836	155..234	265	88.8	Plus
3L	28110227	3L	19471808..19471863	302..247	265	98.2	Minus
3L	28110227	3L	19471847..19471902	341..286	265	98.2	Minus
3L	28110227	3L	19476165..19476220	286..341	265	98.2	Plus
3L	28110227	3L	19476204..19476259	247..302	265	98.2	Plus
3L	28110227	3L	19423004..19423102	392..293	255	86	Minus
3L	28110227	3L	19475123..19475209	332..246	255	86.2	Minus
3L	28110227	3L	19472858..19472914	246..302	240	94.7	Plus
3L	28110227	3L	19423728..19423770	1..43	215	100	Plus
3L	28110227	3L	19467370..19467412	1..43	215	100	Plus
3L	28110227	3L	19472165..19472207	43..1	215	100	Minus
3L	28110227	3L	19475860..19475902	1..43	215	100	Plus
3L	28110227	3L	19478373..19478428	63..118	205	91.1	Plus
3L	28110227	3L	19486877..19486968	302..211	205	81.5	Minus
3L	28110227	3L	19423849..19423904	63..118	190	89.3	Plus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:56

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28103327	3L	19464752..19465206	497..43	2245	99.5	Minus
3L	28103327	3L	19469061..19469514	43..496	2210	99.1	Plus
3L	28103327	3L	19460571..19460830	43..302	1270	99.2	Plus
3L	28103327	3L	19465784..19465944	99..259	670	94.4	Plus
3L	28103327	3L	19468323..19468483	259..99	670	94.4	Minus
3L	28103327	3L	19459828..19459988	259..99	655	93.7	Minus
3L	28103327	3L	19465922..19466109	249..436	580	87.2	Plus
3L	28103327	3L	19460775..19460925	286..436	545	90.7	Plus
3L	28103327	3L	19471530..19471668	102..240	485	89.9	Plus
3L	28103327	3L	19417006..19417144	102..240	485	89.9	Plus
3L	28103327	3L	19465720..19465808	53..141	400	96.6	Plus
3L	28103327	3L	19459964..19460052	141..53	400	96.6	Minus
3L	28103327	3L	19468459..19468547	141..53	400	96.6	Minus
3L	28103327	3L	19416206..19416324	261..143	310	84	Minus
3L	28103327	3L	19471473..19471551	63..141	305	92.4	Plus
3L	28103327	3L	19470753..19470860	436..329	300	85.1	Minus
3L	28103327	3L	19416949..19417027	63..141	290	91.1	Plus
3L	28103327	3L	19481145..19481223	63..141	275	89.8	Plus
3L	28103327	3L	19479883..19480000	436..318	270	83.1	Minus
3L	28103327	3L	19417857..19417936	155..234	265	88.7	Plus
3L	28103327	3L	19416104..19416202	392..293	265	86	Minus
3L	28103327	3L	19468223..19468309	332..246	255	86.2	Minus
3L	28103327	3L	19468253..19468345	341..249	240	83.8	Minus
3L	28103327	3L	19465958..19466014	246..302	240	94.7	Plus
3L	28103327	3L	19481202..19481287	102..187	235	84.8	Plus
3L	28103327	3L	19468960..19469002	1..43	215	100	Plus
3L	28103327	3L	19460470..19460512	1..43	215	100	Plus
3L	28103327	3L	19416828..19416870	1..43	215	100	Plus
3L	28103327	3L	19465265..19465307	43..1	215	100	Minus
3L	28103327	3L	19480017..19480068	262..211	185	90.3	Minus
3L	28103327	3L	19481286..19481345	195..254	180	86.6	Plus
3L	28103327	3L	19457533..19457618	239..154	175	80.2	Minus
3L	28103327	3L	19417811..19417863	70..122	160	86.7	Plus
3L	28103327	3L	19470855..19470926	139..68	150	80.5	Minus

Blast to na_te.dros performed 2019-03-16 00:21:49

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\TART	8500	Dvir\TART TARTVIR 8500bp	2777..2891	173..56	151	60.2	Minus
Dvir\TART	8500	Dvir\TART TARTVIR 8500bp	2764..2999	272..44	143	57.1	Minus

IP20317.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:22:46 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr3L	19461079..19461529	43..493	99	<-	Minus
chr3L	19461589..19461630	1..42	100		Minus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:13 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	1..390	31..420	100		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:54 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	1..390	31..420	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:49:40 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	1..390	31..420	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:50:07 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	1..390	31..420	100		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:58:18 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	1..390	31..420	100		Plus

Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:19 has no hits.

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:54 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	22..459	1..438	100		Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:54 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
825-Oak-RB	22..514	1..493	99		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:49:40 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
825-Oak-RB	22..514	1..493	99		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:50:08 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32213-RB	22..459	1..438	100		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:58:18 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
825-Oak-RB	22..514	1..493	99		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:46 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19471656..19472106	43..493	99	<-	Minus
3L	19472166..19472207	1..42	100		Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:46 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19471656..19472106	43..493	99	<-	Minus
3L	19472166..19472207	1..42	100		Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:46 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19471656..19472106	43..493	99	<-	Minus
3L	19472166..19472207	1..42	100		Minus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:49:40 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_3L	19464756..19465206	43..493	99	<-	Minus
arm_3L	19465266..19465307	1..42	100		Minus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:18 Download gff for IP20317.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19464756..19465206	43..493	99	<-	Minus
3L	19465266..19465307	1..42	100		Minus

IP20317.hyp Sequence

Translation from 0 to 419

> IP20317.hyp
RRSKPNKYFTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAV
VAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLA
APVVAKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI*

IP20317.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:48

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
825-Oak-PB	129	CG32208-PB	1..129	11..139	626	100	Plus
CG32213-PB	129	CG32213-PB	1..129	11..139	623	99.2	Plus
CG12519-PB	131	CG12519-PB	1..131	11..139	528	85.9	Plus
CG12519-PA	131	CG12519-PA	1..131	11..139	528	85.9	Plus
CG32214-PC	116	CG32214-PC	1..116	11..139	523	87.6	Plus

IP20317.pep Sequence

Translation from 0 to 419

> IP20317.pep
RRSKPNKYFTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAV
VAAPAPVVTATSSQVIARNYNGIASAPVIAPVAAPLAAPVVAKYAATPLA
APVVAKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI*

IP20317.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:17:25

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF23675-PA	108	GF23675-PA	1..100	11..126	244	63.9	Plus
Dana\GF23676-PA	120	GF23676-PA	1..120	11..139	217	72.9	Plus
Dana\GF23674-PA	140	GF23674-PA	1..140	11..139	206	73	Plus
Dana\GF10759-PA	139	GF10759-PA	1..137	11..122	205	67.9	Plus
Dana\GF23677-PA	132	GF23677-PA	1..130	11..122	201	67.7	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:17:25

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG13407-PA	135	GG13407-PA	1..135	11..139	316	68.1	Plus
Dere\GG13406-PA	105	GG13406-PA	1..105	11..139	307	72.1	Plus
Dere\GG16035-PA	121	GG16035-PA	1..121	11..139	306	67.6	Plus
Dere\GG13408-PA	155	GG13408-PA	16..149	1..135	152	69.5	Plus
Dere\GG16037-PA	134	GG16037-PA	1..134	11..139	147	73.2	Plus

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:17:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dgri\GH24646-PA	120	GH24646-PA	1..120	11..139	224	70.8	Plus
Dgri\GH22597-PA	126	GH22597-PA	1..126	11..139	216	70	Plus
Dgri\GH22598-PA	118	GH22598-PA	1..116	11..128	209	71.7	Plus
Dgri\GH22599-PA	120	GH22599-PA	1..120	11..139	199	67.7	Plus
Dgri\GH22596-PA	120	GH22596-PA	1..120	11..139	199	67.7	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:56

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG32213-PB	129	CG32213-PB	1..129	11..139	626	100	Plus
825-Oak-PB	129	CG32208-PB	1..129	11..139	623	99.2	Plus
CG12519-PB	131	CG12519-PB	1..131	11..139	525	85.2	Plus
CG12519-PA	131	CG12519-PA	1..131	11..139	525	85.2	Plus
CG32214-PC	116	CG32214-PC	1..116	11..139	520	86.8	Plus
CG32214-PB	116	CG32214-PB	1..116	11..139	520	86.8	Plus
CG18294-PA	141	CG18294-PA	1..141	11..139	475	75.2	Plus
CG14096-PA	122	CG14096-PA	1..116	11..135	405	71	Plus
CG14095-PA	162	CG14095-PA	1..153	11..134	303	50	Plus
CG32212-PA	111	CG32212-PA	1..111	11..139	283	58.5	Plus
CG13678-PA	128	CG13678-PA	1..126	11..139	212	48.1	Plus
CG13068-PA	109	CG13068-PA	1..109	11..128	199	46.7	Plus
CG13674-PB	137	CG13674-PB	5..135	15..139	194	47.1	Plus
CG13674-PA	137	CG13674-PA	5..135	15..139	194	47.1	Plus
CG13047-PB	170	CG13047-PB	1..119	11..136	192	46.5	Plus
CG13679-PB	119	CG13679-PB	5..117	15..139	189	47.3	Plus
CG13044-PA	155	CG13044-PA	1..143	11..138	182	39.3	Plus
CG13049-PA	181	CG13049-PA	2..142	14..136	159	39	Plus
Cpr64Ad-PB	247	CG1259-PB	49..136	29..117	159	48.4	Plus
CG13069-PA	97	CG13069-PA	1..93	11..112	158	45.4	Plus
CG13049-PA	181	CG13049-PA	75..179	20..118	143	41.9	Plus
CG13066-PB	93	CG13066-PB	5..91	14..116	143	43.7	Plus
CG34205-PA	217	CG34205-PA	12..160	3..138	138	35.9	Plus

Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:17:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dmoj\GI11789-PA	104	GI11789-PA	1..98	11..132	243	61.8	Plus
Dmoj\GI13530-PA	164	GI13530-PA	25..164	1..139	199	62.2	Plus
Dmoj\GI11787-PA	161	GI11787-PA	1..160	11..138	150	45.9	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:17:27

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL20932-PA	139	GL20932-PA	1..139	11..139	222	65.5	Plus
Dper\GL20934-PA	62	GL20934-PA	1..61	11..75	161	58.2	Plus
Dper\GL20898-PA	151	GL20898-PA	1..147	11..132	143	43.8	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:17:27

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA28229-PA	126	GA28229-PA	1..126	11..139	181	64.2	Plus
Dpse\GA28232-PA	151	GA28232-PA	1..147	11..132	168	43.1	Plus
Dpse\GA28633-PA	187	GA28633-PA	1..56	11..72	156	75.8	Plus
Dpse\GA28230-PA	131	GA28230-PA	11..127	9..132	143	63.7	Plus
Dpse\GA28228-PA	131	GA28228-PA	11..127	9..132	143	63.7	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:17:28

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM19525-PA	182	GM19525-PA	93..182	50..139	246	86.7	Plus
Dsec\GM18729-PA	154	GM18729-PA	1..125	11..114	149	50.8	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:17:29

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD12284-PA	170	GD12284-PA	26..170	1..139	261	88.3	Plus
Dsim\GD12281-PA	135	GD12281-PA	1..129	11..135	235	81.2	Plus
Dsim\GD14804-PA	151	GD14804-PA	26..151	1..139	232	82.7	Plus
Dsim\GD14802-PA	179	GD14802-PA	26..176	1..114	186	57.6	Plus
Dsim\GD12282-PA	154	GD12282-PA	1..78	11..96	133	60.9	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:17:29

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ13492-PA	122	GJ13492-PA	1..111	11..122	185	74.3	Plus
Dvir\GJ11892-PA	119	GJ11892-PA	1..119	11..139	164	61.1	Plus
Dvir\GJ13493-PA	110	GJ13493-PA	1..103	11..127	145	63.6	Plus
Dvir\GJ13490-PA	140	GJ13490-PA	1..140	11..139	143	48	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:17:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK20211-PA	128	GK20211-PA	1..128	11..139	209	56.5	Plus
Dwil\GK19523-PA	137	GK19523-PA	1..134	11..134	205	53.5	Plus
Dwil\GK20201-PA	138	GK20201-PA	1..138	11..139	202	51.7	Plus
Dwil\GK20194-PA	142	GK20194-PA	1..126	11..130	202	56.1	Plus
Dwil\GK19490-PA	142	GK19490-PA	1..126	11..130	196	50.3	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:17:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE23008-PA	147	GE23008-PA	16..147	1..139	243	74.5	Plus
Dyak\GE15121-PA	142	GE15121-PA	16..142	1..139	240	75.7	Plus
Dyak\GE23069-PA	145	GE23069-PA	16..145	1..139	210	79.9	Plus
Dyak\GE22502-PA	117	GE22502-PA	1..117	11..139	199	74.6	Plus
Dyak\GE22779-PA	124	GE22779-PA	1..118	11..135	138	70.4	Plus

Library:	IP
Tissue Source:	Pooled D melanogaster cDNA libraries
Created by:
Date Registered:	2004-07-08
Comments:
Original Plate Number:	203
Well:	17
Vector:	pOT2
Associated Gene/Transcript	CG32213-RB
Protein status:	IP20317.pep: gold
Sequenced Size:	511

Clone IP20317 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

IP20317.complete Sequence

IP20317.complete Blast Records

IP20317.complete Sim4 Records

IP20317.hyp Sequence

IP20317.hyp Blast Records

IP20317.pep Sequence

IP20317.pep Blast Records