Clone IP20333 Report

Search the DGRC for IP20333

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:203
Well:33
Vector:pOT2
Associated Gene/TranscriptCG13299-RA
Protein status:IP20333.pep: gold
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13299 2008-05-05 Release 5.5 slip selected
CG13299 2008-08-15 Release 5.9 accounting
CG13299 2008-12-18 5.12 accounting

Clone Sequence Records

IP20333.complete Sequence

522 bp assembled on 2008-05-14

GenBank Submission: BT032930

> IP20333.complete
CAATCTCCGGCTAGTGCGAAAAGTACAATCAAAATGACCTCAGAAAGCAA
GATGGTTTTGCTCTTCCTTATCGGATGTCTCGTCATGCAGACAATCAACG
CCCTGCCATTCGATAGATTCAGCCAGGAGGATGACGAACGGAACAACGAG
ATCAGCGGCGAATGGTTCAAGAAACCCATCCTCAGGTTCGATCGTCTTTT
TGCCACCGAAGAATCACCGTCGGGAAGTCGGAAAGAAGTGAGAAGGCCCA
GCAGAAGCGACAAGGGTGAAACCACGGAGAGCTCCAAGCACGCCCACTCC
ATGATCACCTCCATGCTCGGATTCGTGAGCAGTGTCATCAACTTTGGCAG
GACCTTCATAAGGGATCAATAGAAAATATCCTAGTCCATCTGGCACATTT
CGAGATTGCATTTTCCACATGTTGTAGGTTTAAATATTGTTGTTTAAATA
TTGCTTAAATATTGTTGTTCCAAAATAAAAGATTTGGCTTAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

IP20333.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-RA 531 CG13299-RA 15..508 1..494 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6224311..6224706 490..95 1980 100 Minus
chr3L 24539361 chr3L 6224770..6224863 94..1 470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6231801..6232200 494..95 2000 100 Minus
3L 28110227 3L 6232264..6232357 94..1 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6224901..6225300 494..95 2000 100 Minus
3L 28103327 3L 6225364..6225457 94..1 470 100 Minus
Blast to na_te.dros performed 2019-03-16 21:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 974..1043 490..424 116 68.6 Minus

IP20333.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:20:09 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6224311..6224706 95..490 100 <- Minus
chr3L 6224770..6224863 1..94 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:19 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:48:30 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:54:10 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:20 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:16:48 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:54 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:48:30 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 5..494 1..490 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:54:10 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 5..494 1..490 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:20 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 1..339 34..372 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:16:48 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 5..494 1..490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:09 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6231805..6232200 95..490 100 <- Minus
3L 6232264..6232357 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:09 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6231805..6232200 95..490 100 <- Minus
3L 6232264..6232357 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:09 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6231805..6232200 95..490 100 <- Minus
3L 6232264..6232357 1..94 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:54:10 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6224905..6225300 95..490 100 <- Minus
arm_3L 6225364..6225457 1..94 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:27:48 Download gff for IP20333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6224905..6225300 95..490 100 <- Minus
3L 6225364..6225457 1..94 100   Minus

IP20333.hyp Sequence

Translation from 0 to 371

> IP20333.hyp
QSPASAKSTIKMTSESKMVLLFLIGCLVMQTINALPFDRFSQEDDERNNE
ISGEWFKKPILRFDRLFATEESPSGSRKEVRRPSRSDKGETTESSKHAHS
MITSMLGFVSSVINFGRTFIRDQ*

IP20333.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-PA 112 CG13299-PA 1..112 12..123 571 100 Plus

IP20333.pep Sequence

Translation from 0 to 371

> IP20333.pep
QSPASAKSTIKMTSESKMVLLFLIGCLVMQTINALPFDRFSQEDDERNNE
ISGEWFKKPILRFDRLFATEESPSGSRKEVRRPSRSDKGETTESSKHAHS
MITSMLGFVSSVINFGRTFIRDQ*

IP20333.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10908-PA 111 GF10908-PA 1..111 12..122 420 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14068-PA 112 GG14068-PA 1..112 12..123 536 92 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16285-PA 113 GH16285-PA 2..113 14..123 211 46 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-PA 112 CG13299-PA 1..112 12..123 571 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13229-PA 114 GI13229-PA 2..114 14..123 186 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22527-PA 128 GL22527-PA 1..128 12..123 263 45 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12182-PA 128 GA12182-PA 1..128 12..123 269 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13850-PA 112 GM13850-PA 1..112 12..123 576 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13135-PA 112 GD13135-PA 1..112 12..123 576 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12002-PA 108 GJ12002-PA 5..108 17..123 208 45 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17255-PA 119 GK17255-PA 6..119 17..123 257 53 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20493-PA 112 GE20493-PA 1..112 12..123 534 91.1 Plus