BDGP Sequence Production Resources |
Search the DGRC for IP20333
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 203 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13299-RA |
Protein status: | IP20333.pep: gold |
Sequenced Size: | 522 |
Gene | Date | Evidence |
---|---|---|
CG13299 | 2008-05-05 | Release 5.5 slip selected |
CG13299 | 2008-08-15 | Release 5.9 accounting |
CG13299 | 2008-12-18 | 5.12 accounting |
522 bp assembled on 2008-05-14
GenBank Submission: BT032930
> IP20333.complete CAATCTCCGGCTAGTGCGAAAAGTACAATCAAAATGACCTCAGAAAGCAA GATGGTTTTGCTCTTCCTTATCGGATGTCTCGTCATGCAGACAATCAACG CCCTGCCATTCGATAGATTCAGCCAGGAGGATGACGAACGGAACAACGAG ATCAGCGGCGAATGGTTCAAGAAACCCATCCTCAGGTTCGATCGTCTTTT TGCCACCGAAGAATCACCGTCGGGAAGTCGGAAAGAAGTGAGAAGGCCCA GCAGAAGCGACAAGGGTGAAACCACGGAGAGCTCCAAGCACGCCCACTCC ATGATCACCTCCATGCTCGGATTCGTGAGCAGTGTCATCAACTTTGGCAG GACCTTCATAAGGGATCAATAGAAAATATCCTAGTCCATCTGGCACATTT CGAGATTGCATTTTCCACATGTTGTAGGTTTAAATATTGTTGTTTAAATA TTGCTTAAATATTGTTGTTCCAAAATAAAAGATTTGGCTTAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13299-RA | 531 | CG13299-RA | 15..508 | 1..494 | 2470 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Uvir | 6564 | Dvir\Uvir VIRUVIR 6564bp | 974..1043 | 490..424 | 116 | 68.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 6224311..6224706 | 95..490 | 100 | <- | Minus |
chr3L | 6224770..6224863 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 5..494 | 1..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 5..494 | 1..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 1..339 | 34..372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13299-RA | 5..494 | 1..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6231805..6232200 | 95..490 | 100 | <- | Minus |
3L | 6232264..6232357 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6231805..6232200 | 95..490 | 100 | <- | Minus |
3L | 6232264..6232357 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6231805..6232200 | 95..490 | 100 | <- | Minus |
3L | 6232264..6232357 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 6224905..6225300 | 95..490 | 100 | <- | Minus |
arm_3L | 6225364..6225457 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 6224905..6225300 | 95..490 | 100 | <- | Minus |
3L | 6225364..6225457 | 1..94 | 100 | Minus |
Translation from 0 to 371
> IP20333.hyp QSPASAKSTIKMTSESKMVLLFLIGCLVMQTINALPFDRFSQEDDERNNE ISGEWFKKPILRFDRLFATEESPSGSRKEVRRPSRSDKGETTESSKHAHS MITSMLGFVSSVINFGRTFIRDQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13299-PA | 112 | CG13299-PA | 1..112 | 12..123 | 571 | 100 | Plus |
Translation from 0 to 371
> IP20333.pep QSPASAKSTIKMTSESKMVLLFLIGCLVMQTINALPFDRFSQEDDERNNE ISGEWFKKPILRFDRLFATEESPSGSRKEVRRPSRSDKGETTESSKHAHS MITSMLGFVSSVINFGRTFIRDQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10908-PA | 111 | GF10908-PA | 1..111 | 12..122 | 420 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14068-PA | 112 | GG14068-PA | 1..112 | 12..123 | 536 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16285-PA | 113 | GH16285-PA | 2..113 | 14..123 | 211 | 46 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13299-PA | 112 | CG13299-PA | 1..112 | 12..123 | 571 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13229-PA | 114 | GI13229-PA | 2..114 | 14..123 | 186 | 40.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22527-PA | 128 | GL22527-PA | 1..128 | 12..123 | 263 | 45 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12182-PA | 128 | GA12182-PA | 1..128 | 12..123 | 269 | 45.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13850-PA | 112 | GM13850-PA | 1..112 | 12..123 | 576 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13135-PA | 112 | GD13135-PA | 1..112 | 12..123 | 576 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12002-PA | 108 | GJ12002-PA | 5..108 | 17..123 | 208 | 45 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17255-PA | 119 | GK17255-PA | 6..119 | 17..123 | 257 | 53 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20493-PA | 112 | GE20493-PA | 1..112 | 12..123 | 534 | 91.1 | Plus |