Clone IP20362 Report

Search the DGRC for IP20362

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:203
Well:62
Vector:pOT2
Associated Gene/TranscriptCG13068-RA
Protein status:IP20362.pep: gold
Sequenced Size:436

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13068 2008-04-29 Release 5.5 accounting
CG13068 2008-05-05 Release 5.5 slip selected
CG13068 2008-08-15 Release 5.9 accounting
CG13068 2008-12-18 5.12 accounting

Clone Sequence Records

IP20362.complete Sequence

436 bp assembled on 2008-05-14

GenBank Submission: BT031066.1

> IP20362.complete
CTAAACCATCATGTTCAAGCTGTCTGCCCTCGTTGTCCTGTGCGCTCTGG
TGGCCTGCTCCTCGGCTGAGCCCAAGCCCGCTATCCTGGCCGCCGCTCCA
GTGGTTGCAGCTGCTCCTGCCGGCGTGGTCACCGCTACCAGTTCGCAGTA
CGTGGCCCGCAACTTCAACGGTGTGGCTGCTGCTCCAGTTGTTGCCGCTG
CCTACACCGCTCCAGTTGCCGCCGCTGCCTATACCGCTCCAGTTGCCGCC
GCTGCTTATACCGCTCCAGTTGCCGCTGCCTACTCTGCTTATCCGTATGC
CGCCTACCCTTACAGCGCTGCATACACCACTGTTTTGTAAAACGGATTAA
CAAGTATTCAAAACGGATTTGAAATGGAATAAAAATAGACCCGACTGGCA
ATAAAACAAATCAAACTAAAAAAAAAAAAAAAAAAA

IP20362.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-RA 604 CG13068-RA 130..550 1..421 2105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16259216..16259611 22..417 1980 100 Plus
chr3L 24539361 chr3L 16259376..16259443 209..276 280 94.1 Plus
chr3L 24539361 chr3L 16259403..16259470 182..249 280 94.1 Plus
chr3L 24539361 chr3L 8210567..8210649 283..195 180 85.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16269516..16269915 22..421 2000 100 Plus
3L 28110227 3L 16269676..16269743 209..276 280 94.1 Plus
3L 28110227 3L 16269703..16269770 182..249 280 94.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16262616..16263015 22..421 2000 100 Plus
Blast to na_te.dros performed 2019-03-16 20:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2434..2539 277..172 134 62.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2799 222..170 103 66 Minus

IP20362.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:34:41 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16259217..16259369 23..175 100 == Plus
chr3L 16259474..16259611 280..417 100   Plus
chr3L 16259125..16259146 1..22 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:30 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 1..330 11..340 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:51:42 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 1..330 11..340 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:10 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 1..330 11..340 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:50:51 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 1..330 11..340 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:05:57 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 1..330 11..340 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:14:38 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 35..374 1..340 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:51:42 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 34..450 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:10 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 34..450 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:50:52 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 35..374 1..340 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:57 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 34..450 1..417 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:41 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16269517..16269911 23..417 100   Plus
3L 16269425..16269446 1..22 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:41 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16269517..16269911 23..417 100   Plus
3L 16269425..16269446 1..22 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:41 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16269517..16269911 23..417 100   Plus
3L 16269425..16269446 1..22 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:10 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16262525..16262546 1..22 100 -> Plus
arm_3L 16262617..16263011 23..417 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:50 Download gff for IP20362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16262525..16262546 1..22 100 -> Plus
3L 16262617..16263011 23..417 100   Plus

IP20362.hyp Sequence

Translation from 2 to 349

> IP20362.hyp
KPSCSSCLPSLSCALWWPAPRLSPSPLSWPPLQWLQLLLPAWSPLPVRST
WPATSTVWLLLQLLPLPTPLQLPPLPIPLQLPPLLIPLQLPLPTLLIRMP
PTLTALHTPLFCKTD*
Sequence IP20362.hyp has no blast hits.

IP20362.pep Sequence

Translation from 10 to 339

> IP20362.pep
MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVAR
NFNGVAAAPVVAAAYTAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAYP
YSAAYTTVL*

IP20362.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24170-PA 115 GF24170-PA 1..54 1..54 164 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15972-PA 103 GG15972-PA 1..103 1..109 182 91.7 Plus
Dere\GG13406-PA 105 GG13406-PA 1..63 1..62 137 56.7 Plus
Dere\GG16035-PA 121 GG16035-PA 1..63 1..62 137 56.7 Plus
Dere\GG13407-PA 135 GG13407-PA 1..69 1..62 132 52.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15867-PA 123 GH15867-PA 1..62 1..69 176 72.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-PA 109 CG13068-PA 1..109 1..109 531 100 Plus
CG18294-PA 141 CG18294-PA 1..129 1..109 205 47 Plus
825-Oak-PB 129 CG32208-PB 1..118 1..109 202 47.5 Plus
CG32213-PB 129 CG32213-PB 1..118 1..109 199 46.7 Plus
CG12519-PB 131 CG12519-PB 1..120 1..109 195 45.3 Plus
CG12519-PA 131 CG12519-PA 1..120 1..109 195 45.3 Plus
CG14095-PA 162 CG14095-PA 1..131 1..105 191 44.8 Plus
CG32214-PC 116 CG32214-PC 1..109 1..98 190 50.4 Plus
CG32214-PB 116 CG32214-PB 1..109 1..98 190 50.4 Plus
CG14096-PA 122 CG14096-PA 1..118 1..98 183 44.6 Plus
CG13674-PB 137 CG13674-PB 4..100 8..106 160 50.5 Plus
CG13674-PA 137 CG13674-PA 4..100 8..106 160 50.5 Plus
CG13678-PA 128 CG13678-PA 1..105 1..109 159 47.4 Plus
CG13679-PB 119 CG13679-PB 6..101 8..109 157 50.5 Plus
CG13067-PA 79 CG13067-PA 1..77 1..99 156 54.5 Plus
CG13047-PB 170 CG13047-PB 5..139 8..105 155 35.6 Plus
CG13069-PA 97 CG13069-PA 1..91 1..103 142 43.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12648-PA 101 GI12648-PA 1..101 1..109 178 59.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17843-PA 130 GL17843-PA 1..50 1..54 130 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25606-PA 107 GM25606-PA 1..54 1..54 164 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14611-PA 116 GD14611-PA 1..54 1..54 186 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12769-PA 124 GJ12769-PA 1..50 1..54 139 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19539-PA 117 GE19539-PA 1..54 1..54 166 94.4 Plus
Dyak\GE15144-PA 117 GE15144-PA 1..54 1..54 166 94.4 Plus