BDGP Sequence Production Resources |
Search the DGRC for IP20362
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 203 |
Well: | 62 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13068-RA |
Protein status: | IP20362.pep: gold |
Sequenced Size: | 436 |
Gene | Date | Evidence |
---|---|---|
CG13068 | 2008-04-29 | Release 5.5 accounting |
CG13068 | 2008-05-05 | Release 5.5 slip selected |
CG13068 | 2008-08-15 | Release 5.9 accounting |
CG13068 | 2008-12-18 | 5.12 accounting |
436 bp assembled on 2008-05-14
GenBank Submission: BT031066.1
> IP20362.complete CTAAACCATCATGTTCAAGCTGTCTGCCCTCGTTGTCCTGTGCGCTCTGG TGGCCTGCTCCTCGGCTGAGCCCAAGCCCGCTATCCTGGCCGCCGCTCCA GTGGTTGCAGCTGCTCCTGCCGGCGTGGTCACCGCTACCAGTTCGCAGTA CGTGGCCCGCAACTTCAACGGTGTGGCTGCTGCTCCAGTTGTTGCCGCTG CCTACACCGCTCCAGTTGCCGCCGCTGCCTATACCGCTCCAGTTGCCGCC GCTGCTTATACCGCTCCAGTTGCCGCTGCCTACTCTGCTTATCCGTATGC CGCCTACCCTTACAGCGCTGCATACACCACTGTTTTGTAAAACGGATTAA CAAGTATTCAAAACGGATTTGAAATGGAATAAAAATAGACCCGACTGGCA ATAAAACAAATCAAACTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13068-RA | 604 | CG13068-RA | 130..550 | 1..421 | 2105 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16259216..16259611 | 22..417 | 1980 | 100 | Plus |
chr3L | 24539361 | chr3L | 16259376..16259443 | 209..276 | 280 | 94.1 | Plus |
chr3L | 24539361 | chr3L | 16259403..16259470 | 182..249 | 280 | 94.1 | Plus |
chr3L | 24539361 | chr3L | 8210567..8210649 | 283..195 | 180 | 85.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16269516..16269915 | 22..421 | 2000 | 100 | Plus |
3L | 28110227 | 3L | 16269676..16269743 | 209..276 | 280 | 94.1 | Plus |
3L | 28110227 | 3L | 16269703..16269770 | 182..249 | 280 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16262616..16263015 | 22..421 | 2000 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16259217..16259369 | 23..175 | 100 | == | Plus |
chr3L | 16259474..16259611 | 280..417 | 100 | Plus | |
chr3L | 16259125..16259146 | 1..22 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 1..330 | 11..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 1..330 | 11..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 1..330 | 11..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 1..330 | 11..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 1..330 | 11..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 35..374 | 1..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 34..450 | 1..417 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 34..450 | 1..417 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 35..374 | 1..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13068-RA | 34..450 | 1..417 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16269517..16269911 | 23..417 | 100 | Plus | |
3L | 16269425..16269446 | 1..22 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16269517..16269911 | 23..417 | 100 | Plus | |
3L | 16269425..16269446 | 1..22 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16269517..16269911 | 23..417 | 100 | Plus | |
3L | 16269425..16269446 | 1..22 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16262525..16262546 | 1..22 | 100 | -> | Plus |
arm_3L | 16262617..16263011 | 23..417 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16262525..16262546 | 1..22 | 100 | -> | Plus |
3L | 16262617..16263011 | 23..417 | 100 | Plus |
Translation from 2 to 349
> IP20362.hyp KPSCSSCLPSLSCALWWPAPRLSPSPLSWPPLQWLQLLLPAWSPLPVRST WPATSTVWLLLQLLPLPTPLQLPPLPIPLQLPPLLIPLQLPLPTLLIRMP PTLTALHTPLFCKTD*
Translation from 10 to 339
> IP20362.pep MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVAR NFNGVAAAPVVAAAYTAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAYP YSAAYTTVL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24170-PA | 115 | GF24170-PA | 1..54 | 1..54 | 164 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15972-PA | 103 | GG15972-PA | 1..103 | 1..109 | 182 | 91.7 | Plus |
Dere\GG13406-PA | 105 | GG13406-PA | 1..63 | 1..62 | 137 | 56.7 | Plus |
Dere\GG16035-PA | 121 | GG16035-PA | 1..63 | 1..62 | 137 | 56.7 | Plus |
Dere\GG13407-PA | 135 | GG13407-PA | 1..69 | 1..62 | 132 | 52.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15867-PA | 123 | GH15867-PA | 1..62 | 1..69 | 176 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13068-PA | 109 | CG13068-PA | 1..109 | 1..109 | 531 | 100 | Plus |
CG18294-PA | 141 | CG18294-PA | 1..129 | 1..109 | 205 | 47 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..118 | 1..109 | 202 | 47.5 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..118 | 1..109 | 199 | 46.7 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..120 | 1..109 | 195 | 45.3 | Plus |
CG12519-PA | 131 | CG12519-PA | 1..120 | 1..109 | 195 | 45.3 | Plus |
CG14095-PA | 162 | CG14095-PA | 1..131 | 1..105 | 191 | 44.8 | Plus |
CG32214-PC | 116 | CG32214-PC | 1..109 | 1..98 | 190 | 50.4 | Plus |
CG32214-PB | 116 | CG32214-PB | 1..109 | 1..98 | 190 | 50.4 | Plus |
CG14096-PA | 122 | CG14096-PA | 1..118 | 1..98 | 183 | 44.6 | Plus |
CG13674-PB | 137 | CG13674-PB | 4..100 | 8..106 | 160 | 50.5 | Plus |
CG13674-PA | 137 | CG13674-PA | 4..100 | 8..106 | 160 | 50.5 | Plus |
CG13678-PA | 128 | CG13678-PA | 1..105 | 1..109 | 159 | 47.4 | Plus |
CG13679-PB | 119 | CG13679-PB | 6..101 | 8..109 | 157 | 50.5 | Plus |
CG13067-PA | 79 | CG13067-PA | 1..77 | 1..99 | 156 | 54.5 | Plus |
CG13047-PB | 170 | CG13047-PB | 5..139 | 8..105 | 155 | 35.6 | Plus |
CG13069-PA | 97 | CG13069-PA | 1..91 | 1..103 | 142 | 43.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12648-PA | 101 | GI12648-PA | 1..101 | 1..109 | 178 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17843-PA | 130 | GL17843-PA | 1..50 | 1..54 | 130 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25606-PA | 107 | GM25606-PA | 1..54 | 1..54 | 164 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14611-PA | 116 | GD14611-PA | 1..54 | 1..54 | 186 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12769-PA | 124 | GJ12769-PA | 1..50 | 1..54 | 139 | 67.9 | Plus |