Clone IP20372 Report

Search the DGRC for IP20372

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:203
Well:72
Vector:pOT2
Associated Gene/TranscriptCG14870-RA
Protein status:IP20372.pep: gold
Sequenced Size:905

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14870 2008-05-05 Release 5.5 slip selected
CG14870 2008-08-15 Release 5.9 accounting
CG14870 2008-12-18 5.12 accounting

Clone Sequence Records

IP20372.complete Sequence

905 bp assembled on 2008-05-14

GenBank Submission: BT032728

> IP20372.complete
TCAACACTTAGTTTGTGGCCAAGTCAGTTTTGGCAGGTGGAAAATAGTTG
GCACTCGACTTGGCTGGAAACACACCCCGTTGTGAGTCGGCAACCACCAC
CATGAGCGCCAGCGAAGGCATCAGTCTCCCGGGCAACGAGGAAACCACTC
CGCCGCATGAAAAACATAAACAAAAGGCCAAGAAGGCCAAAAAGAAGTCC
CGGAGTGCCAAAGAAAGTGTTCCCAATGCAATGGACGCGAAAGCCACTGC
CAGCTACTTTAGTTTGAGCATCGTGGGCCAAATAGTCTCGGCCACCTTTC
CCCTGGGTCCCGACAAGGAGTTCGTCTTCCTGCGCTACGAAATGGTCGCT
GGTCCCGACTGGCAGCTGTCCTCCGGACCCCAGCACGGACTCACCCAGCT
GGCCACCAATAGAAGGGGCCATTTCAACGAACCGATTGTCTTCAATATGC
CCATCGAGGTGACCTACAAGAGCACCAGTCCATATGGCTGGCCACAGATC
CTGGTGACCGTGTTCGGACGCAGTGGCCTGGGCAGGGAGACACTACTCGG
TTACGCTCACATCCACCTGCCCGTTTTCGGCAGTCGTCGTCCAGCGGATC
AGACGGAGCAGCTGCAGGCGCCCATCCTGATGCCCAAGTGCCCCAACATG
ATGGCGGACATCACCAGTTGGCTGCTGCGCCGCGAGCCGGAGCTGAAGGA
CCCCAAAGTGCTGCTGGACAACCTGAAGTGCAAGGGACTCTCTATGGAGT
CGTACGGCAGCCTACAGTTTCAGCTGTCCTCCGTGATGAGGGGCGCCCGC
AAGCTGGGCTACCATTGGCACTCCTGAGAGAGAGAGTCGAGTCCAGAGTG
TGTTAGTAAAACGTGAACTTGAGGAAGCAGGAAAAAAAAAAAAAAAAAAA
AAAAA

IP20372.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14870-RA 1011 CG14870-RA 42..925 1..884 4420 100 Plus
CG14870.b 1124 CG14870.b 1..884 1..884 4420 100 Plus
CG14870.a 905 CG14870.a 1..489 1..489 2445 100 Plus
CG14870.a 905 CG14870.a 514..905 490..881 1960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11306592..11307081 1..490 2450 100 Plus
chr3R 27901430 chr3R 11307199..11307590 490..881 1870 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15481906..15482395 1..490 2450 100 Plus
3R 32079331 3R 15482513..15482907 490..884 1975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15222737..15223226 1..490 2450 100 Plus
3R 31820162 3R 15223344..15223738 490..884 1975 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:32:32 has no hits.

IP20372.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:42 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11306592..11307080 1..489 100 -> Plus
chr3R 11307199..11307590 490..881 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:32 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:56:32 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:17:59 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:55:41 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:10 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:20:44 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..881 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:56:32 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..881 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:17:59 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..881 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:55:41 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..726 102..827 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:10 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
CG14870-RA 1..881 1..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:42 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15481906..15482394 1..489 100 -> Plus
3R 15482513..15482904 490..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:42 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15481906..15482394 1..489 100 -> Plus
3R 15482513..15482904 490..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:42 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15481906..15482394 1..489 100 -> Plus
3R 15482513..15482904 490..881 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:17:59 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11307628..11308116 1..489 100 -> Plus
arm_3R 11308235..11308626 490..881 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:16 Download gff for IP20372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15222737..15223225 1..489 100 -> Plus
3R 15223344..15223735 490..881 100   Plus

IP20372.hyp Sequence

Translation from 101 to 826

> IP20372.hyp
MSASEGISLPGNEETTPPHEKHKQKAKKAKKKSRSAKESVPNAMDAKATA
SYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQL
ATNRRGHFNEPIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLG
YAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWLLRREPELKD
PKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGYHWHS*

IP20372.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14870-PA 241 CG14870-PA 1..241 1..241 1270 100 Plus

IP20372.pep Sequence

Translation from 101 to 826

> IP20372.pep
MSASEGISLPGNEETTPPHEKHKQKAKKAKKKSRSAKESVPNAMDAKATA
SYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQL
ATNRRGHFNEPIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLG
YAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWLLRREPELKD
PKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGYHWHS*

IP20372.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18301-PA 244 GF18301-PA 1..244 1..241 1094 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16930-PA 241 GG16930-PA 1..241 1..241 1270 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19079-PA 238 GH19079-PA 1..238 1..241 855 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
B9d1-PA 241 CG14870-PA 1..241 1..241 1270 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23223-PA 241 GI23223-PA 32..241 34..241 824 67.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23757-PA 238 GL23757-PA 7..238 6..241 935 77.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13310-PA 238 GA13310-PA 7..238 6..241 932 76.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24239-PA 241 GM24239-PA 1..241 1..241 1265 97.9 Plus
Dsec\GM24237-PA 241 GM24237-PA 1..241 1..241 1265 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19027-PA 241 GD19027-PA 1..241 1..241 1275 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22882-PA 237 GJ22882-PA 18..237 20..241 858 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11463-PA 240 GK11463-PA 4..239 3..240 937 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24315-PA 241 GE24315-PA 1..241 1..241 1224 95.4 Plus