Clone IP20435 Report

Search the DGRC for IP20435

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:35
Vector:pOT2
Associated Gene/TranscriptCG13748-RA
Protein status:IP20435.pep: gold
Sequenced Size:741

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13748 2008-04-29 Release 5.5 accounting
CG13748 2008-08-15 Release 5.9 accounting
CG13748 2008-12-18 5.12 accounting

Clone Sequence Records

IP20435.complete Sequence

741 bp assembled on 2007-10-04

GenBank Submission: BT031067

> IP20435.complete
ACAATCGCCAAGTGATCAAGTGAATTAAATACGAAGCTAAATCAAGTACA
CAAAATGCGCGGACAACTGAAAGAGTACGTTGGAGTGGCAGTGGTGCTGA
TCCTGCTGGCGGGGATCAGATGGAGCGAGGCGTTTCCCATGGACCTCTAC
GACGACGTGAGCGACTTCTTTGACGCCATCTCGCTGGACGATGTGGCCAA
TACCGGGCGCAACACCCATCCGGAGCAGTTCTGCCTCATGCCGGCACGCA
AGGGCGTCTGCCGCGCCCTGATCCCCCGTTGGCGCTACGATCCGGAGCAG
AAGAAGTGCGTGGAGTTCAAGTTCGGCGGCTGTGACGGCAACGAGAACAA
CTTCGCCAGCTACAAGGACTGCATGTCCACCTGCGAGGGCATGTAGGGCT
CTCCGCATCCGCATACGCATTCCGATCCGGATAGCGATCGGTCCTCCGCG
ACCGATGTGTTGCCAAAGGCGGCTGCTTCCCCTCGAGCTCTGCAATCCAG
CGAACCAAAGGCAGCATTCTCCACACCCAAACTCACACACAAACATCACA
ATCCATGCGACTAACCGTCCCTTCTTCTACCTAATATTTATGTAGTTTCT
GTCATTGAATCCATCTACTTTGTACTTTCCTGGGTGTGTCCGTCCAGCAC
TCACCACCCATCTAGAGCTTAAGTTATTGTGATAAAATACTTGTATGGAA
TAAAGAGTTTTTTATAACGACCAAAAAAAAAAAAAAAAAAA

IP20435.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-RA 722 CG13748-RA 1..722 1..722 3610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4827976..4828697 1..722 3610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8940415..8941138 1..724 3620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8941614..8942337 1..724 3620 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:15:35 has no hits.

IP20435.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:16:29 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4827976..4828697 1..722 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:54 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:37:30 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:49 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:42:55 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:12:05 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:06:34 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:37:30 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..722 1..722 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:49 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..722 1..722 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:42:55 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:12:05 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 1..722 1..722 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:29 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8940415..8941136 1..722 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:29 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8940415..8941136 1..722 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:29 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8940415..8941136 1..722 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:49 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4827920..4828641 1..722 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:27 Download gff for IP20435.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8941614..8942335 1..722 100   Plus

IP20435.hyp Sequence

Translation from 54 to 395

> IP20435.hyp
MRGQLKEYVGVAVVLILLAGIRWSEAFPMDLYDDVSDFFDAISLDDVANT
GRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNF
ASYKDCMSTCEGM*

IP20435.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-PA 113 CG13748-PA 1..113 1..113 620 100 Plus
CG3604-PB 132 CG3604-PB 9..105 8..110 146 35 Plus
CG3604-PA 132 CG3604-PA 9..105 8..110 146 35 Plus
Acp24A4-PC 78 CG31779-PC 23..76 58..110 139 44.4 Plus
Acp24A4-PB 78 CG31779-PB 23..76 58..110 139 44.4 Plus

IP20435.pep Sequence

Translation from 54 to 395

> IP20435.pep
MRGQLKEYVGVAVVLILLAGIRWSEAFPMDLYDDVSDFFDAISLDDVANT
GRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNF
ASYKDCMSTCEGM*

IP20435.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12219-PA 115 GF12219-PA 1..115 1..113 485 83.5 Plus
Dana\GF14656-PA 88 GF14656-PA 38..87 62..111 131 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23400-PA 113 GG23400-PA 1..113 1..113 505 93.8 Plus
Dere\GG24416-PA 78 GG24416-PA 21..76 56..110 154 46.4 Plus
Dere\GG24408-PA 132 GG24408-PA 9..105 8..110 148 34 Plus
Dere\GG24411-PA 78 GG24411-PA 23..76 58..110 139 48.1 Plus
Dere\GG24417-PA 78 GG24417-PA 27..76 61..110 136 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21629-PA 114 GH21629-PA 26..114 25..113 457 93.3 Plus
Dgri\GH22482-PA 86 GH22482-PA 36..85 62..111 136 46 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-PA 113 CG13748-PA 1..113 1..113 620 100 Plus
CG3604-PB 132 CG3604-PB 9..105 8..110 146 35 Plus
CG3604-PA 132 CG3604-PA 9..105 8..110 146 35 Plus
fat-spondin-PA 763 CG6953-PA 641..694 57..110 143 40.7 Plus
Acp24A4-PC 78 CG31779-PC 23..76 58..110 139 44.4 Plus
Acp24A4-PB 78 CG31779-PB 23..76 58..110 139 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20083-PA 117 GI20083-PA 29..117 25..113 462 93.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11009-PA 104 GL11009-PA 35..104 29..113 350 81.2 Plus
Dper\GL19461-PA 78 GL19461-PA 24..76 59..110 146 47.2 Plus
Dper\GL19427-PA 78 GL19427-PA 29..77 63..111 137 46.9 Plus
Dper\GL18565-PA 79 GL18565-PA 28..75 63..110 132 43.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12505-PA 119 GA12505-PA 30..119 24..113 477 96.7 Plus
Dpse\GA25970-PA 78 GA25970-PA 24..76 59..110 148 49.1 Plus
Dpse\GA25956-PA 78 GA25956-PA 29..77 63..111 138 46.9 Plus
Dpse\GA25689-PA 79 GA25689-PA 28..75 63..110 135 45.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21081-PA 113 GM21081-PA 1..113 1..113 586 96.5 Plus
Dsec\GM18125-PA 130 GM18125-PA 7..105 8..112 156 37.1 Plus
Dsec\GM18129-PA 107 GM18129-PA 41..105 51..110 137 44.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10616-PA 113 GD10616-PA 1..113 1..113 588 96.5 Plus
Dsim\GD22733-PA 130 GD22733-PA 7..105 8..112 157 37.1 Plus
Dsim\Acp24A4-PA 78 GD22736-PA 27..76 61..110 133 44 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21174-PA 114 GJ21174-PA 25..114 24..113 465 93.3 Plus
Dvir\GJ16348-PA 86 GJ16348-PA 36..85 62..111 129 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17987-PA 113 GK17987-PA 9..113 9..113 497 88.6 Plus
Dwil\GK15471-PA 90 GK15471-PA 40..89 62..111 133 44 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19242-PA 116 GE19242-PA 1..116 1..113 552 91.4 Plus
Dyak\GE14811-PA 130 GE14811-PA 9..105 8..110 154 35.9 Plus
Dyak\GE11642-PA 763 GE11642-PA 643..694 59..110 140 44.2 Plus