Clone IP20436 Report

Search the DGRC for IP20436

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:36
Vector:pOT2
Associated Gene/TranscriptTeh2-RB
Protein status:IP20436.pep: gold
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Teh2 2008-05-05 Release 5.5 slip selected
Teh2 2008-08-15 Release 5.9 accounting
Teh2 2008-12-18 5.12 accounting

Clone Sequence Records

IP20436.complete Sequence

1142 bp assembled on 2008-05-14

GenBank Submission: BT032936

> IP20436.complete
CCGAAACAAAACTAAGAGAACCGTATTTCTCCGCCATGAAGAAGAGCTCC
ACGCTGACCACGACCACGTCGATGCCGGCGAGTCCGACGCTCTCGGCACA
GACGCTCTCCGCCAGCAAGATCAGCCTGAACAGCAGCCGTTGCGGCTCGG
CGGGATCGGGATGCGGATCCGCATCCGGTTCGATGCGCTCCGCCTGCCAA
TCACCGGTGCGGCCGGGGAGCGGATGCGTGGACGCCATCAAGGCCAAGCG
CGAGGAGATCGAGATGGACACGCTGCTCGAGAAGGCAAAGTTCTATACCT
CCGTGTGCCTTGGTACGACTGCCATTTTGTCGGTGTTCACATTCCTCTTC
CTGATACCCTTCGTCGTGGATCCCGCCATCTCAACGATCATAGCCGACTA
TGATCCAGTGCCGGTGACCTGCATCGTCATCGACCATATCTACGCGGAGG
GCATCAAGAATTGCAGCTGGAGCTCCTGCCGCGAGGGCTGCACATCATCA
CTCACCAAGTGCCATCAGTTGTTTGTCAACTATACGCGCATCCCGTTCAG
CGAATGGGAGCGCAATCCTCGGGACCTAGACACGGTCAACTGGGATGTGA
GCTACACCAAGTTTCTGATCAACTCAGAGGGTTGTGGCTATCCGCCCACG
ACCAATTGCAGTATATTTGCCAGGCAATATGGGTTTTCACACATCGGAGA
GCCCTTCCCCTGCTTCTACAGCAGGGCGTATCCGGAGGTGGTCATCGGTC
GGTACTCGTGGGAGAACAATCTGTACCACCTAATCCTTTCGCTGATCATA
CCGAACGTGCTCTTTGCCATCTCGATCGGGGTGCTCAGCTATTGGTACTG
CCCCTGCTGCGAGAAGGCGTGCAACAAATCCTCGCGGGTCTACGCCGAGA
AGTTCCCGACCAAGGAAGAGATCGTTAACTGCATGAAATGTAACACGGAA
AAGTCGTTGTCCTTGAATGTATTTTGAATATGAACTAAAGCGCGAGTGCC
CGACCTTTGATCCCCAGAAATGTATTGTGATAGGTTAAGTGCGATGGTAT
TTGCTATAATCCCTGGATCCCTCGATCCAGATATCTTGCACATATTGTGT
GGCACCCAGTCCTAGCTAGTCCACTGAAAAAAAAAAAAAAAA

IP20436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
Teh2.f 2164 Teh2.f 1038..2164 1..1127 5635 100 Plus
Teh2.c 1345 Teh2.c 219..1345 1..1127 5635 100 Plus
Teh2-RB 1127 Teh2-RB 1..1127 1..1127 5635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4180908..4181222 315..1 1575 100 Minus
chr3L 24539361 chr3L 4180116..4180354 920..682 1195 100 Minus
chr3L 24539361 chr3L 4179535..4179741 1126..920 1035 100 Minus
chr3L 24539361 chr3L 4180638..4180837 511..312 1000 100 Minus
chr3L 24539361 chr3L 4180412..4180591 684..505 885 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4181522..4181836 315..1 1575 100 Minus
3L 28110227 3L 4180730..4180968 920..682 1195 100 Minus
3L 28110227 3L 4180137..4180355 1138..920 1095 100 Minus
3L 28110227 3L 4181252..4181451 511..312 1000 100 Minus
3L 28110227 3L 4181026..4181205 684..505 885 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4181522..4181836 315..1 1575 100 Minus
3L 28103327 3L 4180730..4180968 920..682 1195 100 Minus
3L 28103327 3L 4180137..4180355 1138..920 1095 100 Minus
3L 28103327 3L 4181252..4181451 511..312 1000 100 Minus
3L 28103327 3L 4181026..4181205 684..505 885 99.4 Minus
Blast to na_te.dros performed on 2019-03-16 17:52:14 has no hits.

IP20436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:53:24 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4180117..4180353 683..919 100 <- Minus
chr3L 4179535..4179741 920..1126 100 <- Minus
chr3L 4180414..4180587 509..682 100 <- Minus
chr3L 4180641..4180836 313..508 100 <- Minus
chr3L 4180911..4181222 1..312 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:56 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RA 1..891 36..926 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:32 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1..942 36..977 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:05 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1..942 36..977 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:31 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RA 1..891 36..926 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:20:27 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1..942 36..977 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:37 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RA 1..891 36..926 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:32 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1389..2514 1..1126 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:05 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1389..2514 1..1126 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:31 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RA 1..891 36..926 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:20:27 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
Teh2-RB 1389..2514 1..1126 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:24 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4181028..4181201 509..682 100 <- Minus
3L 4181255..4181450 313..508 100 <- Minus
3L 4180149..4180355 920..1126 100 <- Minus
3L 4180731..4180967 683..919 100 <- Minus
3L 4181525..4181836 1..312 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:24 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4181028..4181201 509..682 100 <- Minus
3L 4181255..4181450 313..508 100 <- Minus
3L 4180149..4180355 920..1126 100 <- Minus
3L 4180731..4180967 683..919 100 <- Minus
3L 4181525..4181836 1..312 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:24 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4181028..4181201 509..682 100 <- Minus
3L 4181255..4181450 313..508 100 <- Minus
3L 4180149..4180355 920..1126 100 <- Minus
3L 4180731..4180967 683..919 100 <- Minus
3L 4181525..4181836 1..312 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:05 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4180149..4180355 920..1126 100 <- Minus
arm_3L 4180731..4180967 683..919 100 <- Minus
arm_3L 4181028..4181201 509..682 100 <- Minus
arm_3L 4181255..4181450 313..508 100 <- Minus
arm_3L 4181525..4181836 1..312 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:51 Download gff for IP20436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4180149..4180355 920..1126 100 <- Minus
3L 4180731..4180967 683..919 100 <- Minus
3L 4181028..4181201 509..682 100 <- Minus
3L 4181255..4181450 313..508 100 <- Minus
3L 4181525..4181836 1..312 100   Minus

IP20436.pep Sequence

Translation from 2 to 976

> IP20436.pep
ETKLREPYFSAMKKSSTLTTTTSMPASPTLSAQTLSASKISLNSSRCGSA
GSGCGSASGSMRSACQSPVRPGSGCVDAIKAKREEIEMDTLLEKAKFYTS
VCLGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEG
IKNCSWSSCREGCTSSLTKCHQLFVNYTRIPFSEWERNPRDLDTVNWDVS
YTKFLINSEGCGYPPTTNCSIFARQYGFSHIGEPFPCFYSRAYPEVVIGR
YSWENNLYHLILSLIIPNVLFAISIGVLSYWYCPCCEKACNKSSRVYAEK
FPTKEEIVNCMKCNTEKSLSLNVF*

IP20436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23881-PA 311 GF23881-PA 1..301 12..310 1362 91 Plus
Dana\GF17145-PA 279 GF17145-PA 26..242 78..295 316 36 Plus
Dana\GF10561-PA 455 GF10561-PA 3..96 84..177 223 46.8 Plus
Dana\GF10561-PA 455 GF10561-PA 225..302 203..282 158 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14213-PA 309 GG14213-PA 1..299 12..310 1563 98.3 Plus
Dere\GG17316-PA 279 GG17316-PA 26..237 78..288 314 35.8 Plus
Dere\GG15201-PA 452 GG15201-PA 3..96 84..177 221 45.7 Plus
Dere\GG15201-PA 452 GG15201-PA 222..299 203..282 159 40 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15550-PA 301 GH15550-PA 47..291 66..310 1273 94.7 Plus
Dgri\GH14179-PA 267 GH14179-PA 36..247 78..288 315 34.7 Plus
Dgri\GH15930-PA 464 GH15930-PA 3..122 84..195 226 39.2 Plus
Dgri\GH15930-PA 464 GH15930-PA 202..310 174..282 164 36 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Teh2-PB 313 CG15004-PB 1..313 12..324 1679 100 Plus
Teh2-PA 309 CG15004-PA 1..299 12..310 1585 98.7 Plus
Teh1-PA 279 CG12806-PA 41..237 93..288 321 37 Plus
Teh1-PB 299 CG12806-PB 41..237 93..288 321 37 Plus
tipE-PB 452 CG1232-PB 3..96 84..177 224 45.7 Plus
tipE-PA 452 CG1232-PA 3..96 84..177 224 45.7 Plus
tipE-PB 452 CG1232-PB 226..299 207..282 163 42.1 Plus
tipE-PA 452 CG1232-PA 226..299 207..282 163 42.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16825-PA 298 GI16825-PA 44..288 66..310 1261 93.5 Plus
Dmoj\GI22088-PA 279 GI22088-PA 26..242 78..295 313 36.5 Plus
Dmoj\GI21413-PA 456 GI21413-PA 3..122 84..195 227 40 Plus
Dmoj\GI16579-PA 456 GI16579-PA 3..122 84..195 227 40 Plus
Dmoj\GI21413-PA 456 GI21413-PA 199..302 179..282 161 36.8 Plus
Dmoj\GI16579-PA 456 GI16579-PA 199..302 179..282 161 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12733-PA 151 GL12733-PA 1..145 12..162 452 81.5 Plus
Dper\GL23218-PA 232 GL23218-PA 34..186 137..288 235 37.8 Plus
Dper\GL12833-PA 455 GL12833-PA 3..96 84..177 221 45.7 Plus
Dper\GL12833-PA 455 GL12833-PA 194..302 174..282 168 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13422-PA 304 GA13422-PA 1..294 12..310 1317 92.3 Plus
Dpse\GA11821-PB 279 GA11821-PB 26..237 78..288 316 36.7 Plus
Dpse\GA11553-PA 455 GA11553-PA 3..96 84..177 221 45.7 Plus
Dpse\GA11553-PA 455 GA11553-PA 194..302 174..282 168 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14005-PA 309 GM14005-PA 1..299 12..310 1563 98.3 Plus
Dsec\GM26201-PA 279 GM26201-PA 26..237 78..288 315 35.8 Plus
Dsec\GM14633-PA 452 GM14633-PA 3..96 84..177 221 45.7 Plus
Dsec\GM14633-PA 452 GM14633-PA 222..299 203..282 159 40 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13286-PA 309 GD13286-PA 1..299 12..310 1563 98.3 Plus
Dsim\GD20749-PA 279 GD20749-PA 26..237 78..288 315 35.8 Plus
Dsim\GD13821-PA 434 GD13821-PA 3..96 84..177 221 45.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12573-PA 298 GJ12573-PA 44..288 66..310 1251 91.8 Plus
Dvir\GJ24203-PA 279 GJ24203-PA 26..237 78..288 312 36.7 Plus
Dvir\GJ12831-PA 485 GJ12831-PA 5..121 87..195 224 41 Plus
Dvir\GJ12831-PA 485 GJ12831-PA 195..303 174..282 160 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10267-PA 302 GK10267-PA 20..292 29..310 1361 90.4 Plus
Dwil\GK14508-PA 321 GK14508-PA 26..237 78..288 305 35.8 Plus
Dwil\GK12714-PA 464 GK12714-PA 3..118 84..191 217 39.7 Plus
Dwil\GK12714-PA 464 GK12714-PA 203..311 174..282 161 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20641-PA 309 GE20641-PA 1..299 12..310 1563 98.3 Plus
Dyak\GE24718-PA 279 GE24718-PA 26..237 78..288 314 35.8 Plus
Dyak\GE21421-PA 452 GE21421-PA 3..96 84..177 221 45.7 Plus
Dyak\GE21421-PA 452 GE21421-PA 222..299 203..282 159 40 Plus

IP20436.hyp Sequence

Translation from 2 to 976

> IP20436.hyp
ETKLREPYFSAMKKSSTLTTTTSMPASPTLSAQTLSASKISLNSSRCGSA
GSGCGSASGSMRSACQSPVRPGSGCVDAIKAKREEIEMDTLLEKAKFYTS
VCLGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEG
IKNCSWSSCREGCTSSLTKCHQLFVNYTRIPFSEWERNPRDLDTVNWDVS
YTKFLINSEGCGYPPTTNCSIFARQYGFSHIGEPFPCFYSRAYPEVVIGR
YSWENNLYHLILSLIIPNVLFAISIGVLSYWYCPCCEKACNKSSRVYAEK
FPTKEEIVNCMKCNTEKSLSLNVF*

IP20436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Teh2-PB 313 CG15004-PB 1..313 12..324 1679 100 Plus
Teh2-PA 309 CG15004-PA 1..299 12..310 1585 98.7 Plus
Teh1-PA 279 CG12806-PA 41..237 93..288 321 37 Plus
Teh1-PB 299 CG12806-PB 41..237 93..288 321 37 Plus
tipE-PB 452 CG1232-PB 3..96 84..177 224 45.7 Plus