Clone IP20443 Report

Search the DGRC for IP20443

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:43
Vector:pOT2
Associated Gene/TranscriptCG33468-RA
Protein status:IP20443.pep: gold
Sequenced Size:595

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33468 2008-05-05 Release 5.5 slip selected
CG33468 2008-08-15 Release 5.9 accounting
CG33468 2008-12-18 5.12 accounting

Clone Sequence Records

IP20443.complete Sequence

595 bp assembled on 2008-05-14

GenBank Submission: BT032736

> IP20443.complete
AGATGACAACATCTGCTGTTGAAGCTCCCAATAGTGCATATCCCGATTTA
GAAAAGCGACTGGAAAGGTATTTGCGAAGTGTGTTTTGCCTAAAGGAAAT
CGATACTAAAAATGAGTACATTCCAACCGAAGTGGAGTACTTTGGAGTTC
TGAGTTTAAGCGATGTTCGAGCGCCTCGCCGAAAACTGTGGTACATGTAC
TATGCGACAACAGATCAGGTGGACAAAACTGTGGATCAGATCCATCGTAA
ATATGGCCAAAAGAATATGTACGAGCTGTTCAGAAAACCGGTATATACAG
GGGCTGGAATGCGATCCCGTGTTAAGAACCACTTTAAAGGGCTTAAGTGG
CACGTAAAAGGAAACATTTTGGAAGCCCCGCTAGGTAGCTCCCTTAATGA
TGAGAAAGTGGTTAACACAATTGCAGATTTATATCAGAACGAAAGGAGAA
GATACTTCGATTACCTTATGTCTAGGAGTAATCTGTATAAATCGTGTACA
TATCGAAACATAAATGCATAAAATATTTTCATTTATGTATAAGACTTTCT
AGAATAAAGCTTTAAAATAATAAATGCCAAAAAAAAAAAAAAAAA

IP20443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33468-RA 700 CG33468-RA 113..696 1..584 2905 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10493620..10494164 578..34 2725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14606311..14606861 584..34 2740 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14607510..14608060 584..34 2740 99.8 Minus
2R 25260384 2R 14608126..14608160 35..1 175 100 Minus
Blast to na_te.dros performed 2019-03-16 09:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1027..1074 552..506 111 75.5 Minus
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 2326..2364 94..132 105 74.4 Plus

IP20443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:41:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10493620..10494164 34..578 100 <- Minus
chr2R 10494232..10494264 1..33 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:20:58 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:21 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:03:51 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:33 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:15 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:21 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..578 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:03:51 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 20..597 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:33 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 1..519 3..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
CG33468-RA 20..597 1..578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14606317..14606861 34..578 100 <- Minus
2R 14606929..14606961 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14606317..14606861 34..578 100 <- Minus
2R 14606929..14606961 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:27 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14606317..14606861 34..578 100 <- Minus
2R 14606929..14606961 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:03:51 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10493822..10494366 34..578 100 <- Minus
arm_2R 10494434..10494466 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:19 Download gff for IP20443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14607516..14608060 34..578 100 <- Minus
2R 14608128..14608160 1..33 100   Minus

IP20443.pep Sequence

Translation from 2 to 520

> IP20443.pep
MTTSAVEAPNSAYPDLEKRLERYLRSVFCLKEIDTKNEYIPTEVEYFGVL
SLSDVRAPRRKLWYMYYATTDQVDKTVDQIHRKYGQKNMYELFRKPVYTG
AGMRSRVKNHFKGLKWHVKGNILEAPLGSSLNDEKVVNTIADLYQNERRR
YFDYLMSRSNLYKSCTYRNINA*

IP20443.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13526-PA 176 GF13526-PA 1..164 1..160 575 65.9 Plus
Dana\GF13527-PA 168 GF13527-PA 1..165 1..163 420 47.3 Plus
Dana\GF19839-PA 159 GF19839-PA 1..144 20..163 286 39.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16565-PA 133 GG16565-PA 1..133 18..172 563 72.3 Plus
Dere\GG22414-PA 163 GG22414-PA 12..156 15..159 404 50.3 Plus
Dere\GG22413-PA 160 GG22413-PA 1..148 16..163 291 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21117-PA 155 GH21117-PA 8..147 16..158 353 46.9 Plus
Dgri\GH21115-PA 150 GH21115-PA 11..150 20..159 345 47.1 Plus
Dgri\GH21116-PA 156 GH21116-PA 9..148 16..158 342 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33468-PA 172 CG33468-PA 1..172 1..172 910 100 Plus
CG12868-PB 167 CG12868-PB 1..160 1..159 405 47.5 Plus
CG33469-PB 160 CG33469-PB 1..141 16..156 294 36.2 Plus
CG33469-PA 160 CG33469-PA 1..141 16..156 294 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18721-PA 141 GI18721-PA 1..129 27..155 373 49.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10638-PA 158 GL10638-PA 35..158 44..167 423 58.9 Plus
Dper\GL10639-PA 127 GL10639-PA 12..121 6..115 421 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24428-PA 178 GA24428-PA 12..171 6..165 554 61.9 Plus
Dpse\GA11869-PA 138 GA11869-PA 15..138 44..167 423 58.9 Plus
Dpse\GA24429-PA 231 GA24429-PA 108..228 44..164 410 58.7 Plus
Dpse\GA24429-PA 231 GA24429-PA 10..137 31..161 353 51.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20200-PA 172 GM20200-PA 1..172 1..172 860 93.6 Plus
Dsec\GM20202-PA 163 GM20202-PA 12..156 15..159 390 48.3 Plus
Dsec\GM20201-PA 160 GM20201-PA 1..148 16..163 282 33.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25671-PA 172 GD25671-PA 1..172 1..172 861 93.6 Plus
Dsim\GD25672-PA 160 GD25672-PA 1..148 16..163 301 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21739-PA 141 GJ21739-PA 1..136 27..162 350 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15732-PA 148 GK15732-PA 13..137 41..160 456 68 Plus
Dwil\GK15731-PA 137 GK15731-PA 13..126 42..155 338 48.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12301-PA 172 GE12301-PA 1..172 1..172 780 84.3 Plus
Dyak\GE12303-PA 163 GE12303-PA 12..156 15..159 392 49 Plus
Dyak\GE12302-PA 156 GE12302-PA 1..144 20..163 291 36.8 Plus

IP20443.hyp Sequence

Translation from 2 to 520

> IP20443.hyp
MTTSAVEAPNSAYPDLEKRLERYLRSVFCLKEIDTKNEYIPTEVEYFGVL
SLSDVRAPRRKLWYMYYATTDQVDKTVDQIHRKYGQKNMYELFRKPVYTG
AGMRSRVKNHFKGLKWHVKGNILEAPLGSSLNDEKVVNTIADLYQNERRR
YFDYLMSRSNLYKSCTYRNINA*

IP20443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33468-PA 172 CG33468-PA 1..172 1..172 910 100 Plus
CG12868-PB 167 CG12868-PB 1..160 1..159 405 47.5 Plus
CG33469-PB 160 CG33469-PB 1..141 16..156 294 36.2 Plus
CG33469-PA 160 CG33469-PA 1..141 16..156 294 36.2 Plus