Clone IP20458 Report

Search the DGRC for IP20458

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:58
Vector:pOT2
Associated Gene/TranscriptCG42449-RA
Protein status:IP20458.pep: gold
Sequenced Size:1164

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15778 2008-05-05 Release 5.5 slip selected
CG42449 2008-12-18 5.12 accounting

Clone Sequence Records

IP20458.complete Sequence

1164 bp assembled on 2008-05-14

GenBank Submission: BT032740

> IP20458.complete
AGCAGCTCCAGTTAAGTCATAATGGCCAGATATCAGAGTAGCCTTAGCCT
CGGAATCCTTGTGGTCCTGCTAATCGATCAGCTGGCCAACGCCCAGTTCG
TTCCGGGCCCAATCTCTGGACCAATTCCCCGCCAGCAGAGATCGCTCTTT
GGGTCCGGTCCGCCGCCCGGTTGGAGTAGCGGTGGCCTCAGTCACGGCTG
GAATAGTCCCAGCTTTGAGTTTAGCCCGCTGCCGCCATCGCACAGTTCGC
ATGTGACCAAGGACGAGTTGCTGGCCCTGCTAGCCGCCTGGAAGGATGTG
GCCAAGCCGACGACTCCGGCACCGGAGCCAGAGCCCGAGGAGCCCGAACC
CGAGCCGGAGGCCACAACGCCAGCGCCGCCAGAGGATGTGGACGAACCGG
AACCGGAGCCCGAGGCACCGGCACCGGCACCGGCACCAGAGGCGCCAGCT
GGTCCACCACCCGGCGTTCCCGTCACCGTCTCCCTGCCCGCCCTGGTGCC
CATTCAATTGGCGGCCATGTGGCAACAGCCGGCGCTGGGAGCAGCGGCCG
GCGGACTGGGTCCTCTAAATCTGGGCGGCCTGGGTCTGGGCGGTGGCATT
GCATTGAACACGCTCGGCGGCGGTGCGGTAGCAGCCGGAGGAGCTATAGC
GGCCGGAGGCGGTGGAGCGGCGGCCGCCGGAGCAGCAGCAGCAGCGTCAC
GTTCCGGAGTGGCACGCCCTCGAGCCCGGGCCAGGATCGGAGGACGTGCG
TCCAATGCCCAGCAGCCCGCCATACGTTTCCCGGTGGCCAATCCGCGCAG
CTTCACCTCGAACAACTATGTGGCGCCCAGGCCGCGTTATTATCGCGATA
CGGAGCCCATGCGCGTCAACGTAATGGCACCACCGCCGCCGTCGCCCTAC
CAAATGGCCAATATCCAGGGTCCCGTTCAGCTGGTGCCCGCCTACTGGCA
ATAGGCCCATTATTCAGCTACCAAGTCTTACAAGTCGTACTGCCACTTCT
CTCTAAGCTAAACTGTACAAAGTTATATGTTATAGTAATACGCGCCAGTG
CATATAGAATATAGAATGCCATGGCCTGTTAACAAGTCGTATGTATGTAT
GTTTTTTTTTTTTTGATTATACCAATAAAATATTTTAACAAACTATAAAA
AAAAAAAAAAAAAA

IP20458.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42449.a 1660 CG42449.a 514..1660 1..1147 5735 100 Plus
CG42449-RA 1255 CG42449-RA 109..1255 1..1147 5735 100 Plus
CG42449-RB 1218 CG42449-RB 1..863 1..863 4315 100 Plus
CG42449-RB 1218 CG42449-RB 934..1218 863..1147 1425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5575644..5576506 1..863 4285 99.8 Plus
chrX 22417052 chrX 5576577..5576860 863..1146 1420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5683240..5684102 1..863 4315 100 Plus
X 23542271 X 5684173..5684457 863..1147 1425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5691338..5692200 1..863 4315 100 Plus
X 23527363 X 5692271..5692555 863..1147 1425 100 Plus
Blast to na_te.dros performed 2019-03-15 14:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 639..753 697..587 132 62.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2783..2860 622..699 120 61.5 Plus
transib1 2167 transib1 TRANSIB1 2167bp 1902..1952 1092..1142 120 70.6 Plus

IP20458.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:57:39 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5575644..5576506 1..863 99 -> Plus
chrX 5576578..5576860 864..1146 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:11 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..933 22..954 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:06 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..933 22..954 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:53:00 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..933 22..954 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 14:49:29 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:17:56 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..933 22..954 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:02 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..1146 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:06 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..1146 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:53:00 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..1146 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:49:29 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:17:56 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
CG42449-RA 1..1146 1..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:57:39 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
X 5683240..5684102 1..863 100 -> Plus
X 5684174..5684456 864..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:57:39 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
X 5683240..5684102 1..863 100 -> Plus
X 5684174..5684456 864..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:57:39 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
X 5683240..5684102 1..863 100 -> Plus
X 5684174..5684456 864..1146 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:53:00 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5578207..5578489 864..1146 100   Plus
arm_X 5577273..5578135 1..863 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:49 Download gff for IP20458.complete
Subject Subject Range Query Range Percent Splice Strand
X 5691338..5692200 1..863 100 -> Plus
X 5692272..5692554 864..1146 100   Plus

IP20458.pep Sequence

Translation from 21 to 953

> IP20458.pep
MARYQSSLSLGILVVLLIDQLANAQFVPGPISGPIPRQQRSLFGSGPPPG
WSSGGLSHGWNSPSFEFSPLPPSHSSHVTKDELLALLAAWKDVAKPTTPA
PEPEPEEPEPEPEATTPAPPEDVDEPEPEPEAPAPAPAPEAPAGPPPGVP
VTVSLPALVPIQLAAMWQQPALGAAAGGLGPLNLGGLGLGGGIALNTLGG
GAVAAGGAIAAGGGGAAAAGAAAAASRSGVARPRARARIGGRASNAQQPA
IRFPVANPRSFTSNNYVAPRPRYYRDTEPMRVNVMAPPPPSPYQMANIQG
PVQLVPAYWQ*

IP20458.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21368-PA 293 GF21368-PA 17..293 20..310 397 62.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18775-PA 305 GG18775-PA 1..305 1..310 866 85.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12674-PA 266 GH12674-PA 20..266 21..310 230 43.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42449-PA 310 CG42449-PA 1..310 1..310 1637 100 Plus
CG42449-PB 281 CG42449-PB 1..281 1..281 1475 100 Plus
CG13358-PD 301 CG13358-PB 10..191 10..197 230 34.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16251-PA 277 GI16251-PA 7..277 6..310 315 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18238-PA 300 GL18238-PA 39..300 37..310 356 57.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13951-PA 300 GA13951-PA 39..300 37..310 356 57.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12426-PA 142 GM12426-PA 1..142 166..310 431 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16743-PA 304 GD16743-PA 1..304 1..310 857 86.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16716-PA 281 GJ16716-PA 224..281 251..310 149 50.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19971-PA 290 GK19971-PA 12..290 14..310 232 44.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16418-PA 300 GE16418-PA 1..300 1..310 843 84.5 Plus

IP20458.hyp Sequence

Translation from 21 to 953

> IP20458.hyp
MARYQSSLSLGILVVLLIDQLANAQFVPGPISGPIPRQQRSLFGSGPPPG
WSSGGLSHGWNSPSFEFSPLPPSHSSHVTKDELLALLAAWKDVAKPTTPA
PEPEPEEPEPEPEATTPAPPEDVDEPEPEPEAPAPAPAPEAPAGPPPGVP
VTVSLPALVPIQLAAMWQQPALGAAAGGLGPLNLGGLGLGGGIALNTLGG
GAVAAGGAIAAGGGGAAAAGAAAAASRSGVARPRARARIGGRASNAQQPA
IRFPVANPRSFTSNNYVAPRPRYYRDTEPMRVNVMAPPPPSPYQMANIQG
PVQLVPAYWQ*

IP20458.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG42449-PA 310 CG42449-PA 1..310 1..310 1637 100 Plus
CG42449-PB 281 CG42449-PB 1..281 1..281 1475 100 Plus
CG13358-PD 301 CG13358-PB 10..191 10..197 230 34.8 Plus