Clone IP20469 Report

Search the DGRC for IP20469

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:69
Vector:pOT2
Associated Gene/TranscriptCG14096-RA
Protein status:IP20469.pep: gold
Sequenced Size:463

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14096 2008-04-29 Release 5.5 accounting
CG14096 2008-05-05 Release 5.5 slip selected
CG14096 2008-08-15 Release 5.9 accounting
CG14096 2008-12-18 5.12 accounting

Clone Sequence Records

IP20469.complete Sequence

463 bp assembled on 2008-05-14

GenBank Submission: BT031069

> IP20469.complete
AGTTTTCGAACCGTAAGCACCAGATCCATAATCATAATGTTCAAATCCGC
CGTTGTTATTCTGGCTATCGTTGCCTGCGCTGCTGCCAAGCCTGGACTTC
TGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTTACTCTGCTCCTCTG
GCTTACTCAGCTCCTGCTGCCGTGGTAGCTGCTCCCGCTCCAGTTGTGAC
CGCCACCAGTAGCCAGGTTATCGCCAGGAACTACAATGGAATCGCCGTTG
CTCCTGTGATTGCTCCCGTTGCCGCTCCTGTGGTGGCCAAGTACACTGCT
GCTCCTTTTGCCTACGCTTCTCCTTTGGCCTACTCCGCTCCTCTGGCTTA
CACTTCTCCATTGGCTTATAAAACTCTTCCGGCTGCTGCTCCAGTTCTTC
TGTAAGAACGTCGACTGATCAATAAAAATACAAAAAAATGAGATAAAAAA
AAAAAAAAAAAAA

IP20469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-RA 458 CG14096-RA 15..458 1..444 2220 100 Plus
CG18294-RA 503 CG18294-RA 15..326 1..312 1500 98.7 Plus
CG33255-RA 768 CG33255-RA 225..420 69..264 710 90.8 Plus
CG33255-RA 768 CG33255-RA 77..176 266..167 335 89 Minus
CG33255-RA 768 CG33255-RA 566..645 179..258 295 91.2 Plus
CG33255-RA 768 CG33255-RA 661..717 316..372 240 94.7 Plus
CG33255-RA 768 CG33255-RA 637..696 274..333 180 86.6 Plus
CG33255-RA 768 CG33255-RA 520..572 76..128 145 84.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19455989..19456383 444..50 1885 98.5 Minus
chr3L 24539361 chr3L 19464617..19464880 312..49 1260 98.5 Minus
chr3L 24539361 chr3L 19462033..19462289 49..305 1255 99.2 Plus
chr3L 24539361 chr3L 19456903..19457109 59..283 715 88.9 Plus
chr3L 24539361 chr3L 19413274..19413469 69..264 710 90.8 Plus
chr3L 24539361 chr3L 19465394..19465600 59..283 700 88.4 Plus
chr3L 24539361 chr3L 19467798..19467993 69..264 695 90.3 Plus
chr3L 24539361 chr3L 19461313..19461519 283..59 685 88 Minus
chr3L 24539361 chr3L 19477480..19477743 69..341 685 84.2 Plus
chr3L 24539361 chr3L 19412550..19412649 266..167 335 89 Minus
chr3L 24539361 chr3L 19414163..19414242 179..258 295 91.2 Plus
chr3L 24539361 chr3L 19414258..19414314 316..372 255 96.5 Plus
chr3L 24539361 chr3L 19456439..19456487 49..1 245 100 Minus
chr3L 24539361 chr3L 19461930..19461978 1..49 245 100 Plus
chr3L 24539361 chr3L 19464935..19464983 49..1 245 100 Minus
chr3L 24539361 chr3L 19453846..19453931 263..178 205 82.6 Minus
chr3L 24539361 chr3L 19414234..19414293 274..333 195 88.3 Plus
chr3L 24539361 chr3L 19412803..19412851 49..1 185 91.8 Minus
chr3L 24539361 chr3L 19467329..19467377 49..1 185 91.8 Minus
chr3L 24539361 chr3L 19476596..19476644 49..1 185 91.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
CR32205-RA 1085 CR32205-RA 140..335 264..69 710 90.8 Minus
pncr009:3L-RA 961 CR33940-RA 202..344 211..69 430 86.7 Minus
pncr009:3L-RA 961 CR33940-RA 81..203 341..219 375 86.9 Minus
CR32205-RA 1085 CR32205-RA 699..798 167..266 335 89 Plus
CR32205-RA 1085 CR32205-RA 552..649 1..98 280 85.7 Plus
pncr009:3L-RA 961 CR33940-RA 553..605 1..53 190 90.5 Plus
pncr009:3L-RA 961 CR33940-RA 739..787 235..283 155 87.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19466564..19466962 447..49 1995 100 Minus
3L 28110227 3L 19475194..19475457 312..49 1260 98.5 Minus
3L 28110227 3L 19472610..19472866 49..305 1255 99.2 Plus
3L 28110227 3L 19478373..19478568 69..264 725 91.3 Plus
3L 28110227 3L 19423849..19424044 69..264 710 90.8 Plus
3L 28110227 3L 19467481..19467687 59..283 685 88 Plus
3L 28110227 3L 19471890..19472096 283..59 685 88 Minus
3L 28110227 3L 19475971..19476177 59..283 685 88 Plus
3L 28110227 3L 19488045..19488308 69..341 670 83.9 Plus
3L 28110227 3L 19423125..19423224 266..167 335 89 Minus
3L 28110227 3L 19424757..19424836 179..258 295 91.2 Plus
3L 28110227 3L 19467017..19467065 49..1 245 100 Minus
3L 28110227 3L 19472507..19472555 1..49 245 100 Plus
3L 28110227 3L 19475512..19475560 49..1 245 100 Minus
3L 28110227 3L 19424852..19424908 316..372 240 94.7 Plus
3L 28110227 3L 19464433..19464518 263..178 205 82.6 Minus
3L 28110227 3L 19423378..19423426 49..1 185 91.8 Minus
3L 28110227 3L 19477906..19477954 49..1 185 91.8 Minus
3L 28110227 3L 19487161..19487209 49..1 185 91.8 Minus
3L 28110227 3L 19424828..19424887 274..333 180 86.7 Plus
3L 28110227 3L 19424914..19424949 393..428 180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19459664..19460062 447..49 1995 100 Minus
3L 28103327 3L 19468294..19468557 312..49 1260 98.4 Minus
3L 28103327 3L 19465710..19465966 49..305 1255 99.2 Plus
3L 28103327 3L 19471473..19471668 69..264 725 91.3 Plus
3L 28103327 3L 19416949..19417144 69..264 710 90.8 Plus
3L 28103327 3L 19460627..19460787 123..283 655 93.7 Plus
3L 28103327 3L 19469117..19469277 123..283 655 93.7 Plus
3L 28103327 3L 19464990..19465150 283..123 655 93.7 Minus
3L 28103327 3L 19481145..19481287 69..211 430 86.7 Plus
3L 28103327 3L 19469071..19469159 59..147 400 96.6 Plus
3L 28103327 3L 19460581..19460669 59..147 400 96.6 Plus
3L 28103327 3L 19465108..19465196 147..59 400 96.6 Minus
3L 28103327 3L 19481286..19481408 219..341 375 86.9 Plus
3L 28103327 3L 19416225..19416324 266..167 335 89 Minus
3L 28103327 3L 19417857..19417936 179..258 295 91.2 Plus
3L 28103327 3L 19465607..19465655 1..49 245 100 Plus
3L 28103327 3L 19468612..19468660 49..1 245 100 Minus
3L 28103327 3L 19460117..19460165 49..1 245 100 Minus
3L 28103327 3L 19417952..19418008 316..372 240 94.7 Plus
3L 28103327 3L 19457533..19457618 263..178 205 82.5 Minus
3L 28103327 3L 19471006..19471054 49..1 185 91.8 Minus
3L 28103327 3L 19480261..19480309 49..1 185 91.8 Minus
3L 28103327 3L 19416478..19416526 49..1 185 91.8 Minus
3L 28103327 3L 19418014..19418049 393..428 180 100 Plus
3L 28103327 3L 19417928..19417987 274..333 180 86.6 Plus
3L 28103327 3L 19470855..19470938 145..62 165 79.7 Minus
3L 28103327 3L 19468262..19468306 305..261 165 91.1 Minus
3L 28103327 3L 19468176..19468267 352..261 160 78.2 Minus
3L 28103327 3L 19480020..19480068 283..235 155 87.7 Minus
3L 28103327 3L 19417811..19417863 76..128 145 84.9 Plus
3L 28103327 3L 19468450..19468501 351..300 140 84.6 Minus
3L 28103327 3L 19465766..19465817 300..351 140 84.6 Plus
Blast to na_te.dros performed 2019-03-16 17:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2777..2849 197..122 147 69.7 Minus

IP20469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:49:59 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19456010..19456384 49..423 98 <- Minus
chr3L 19456440..19456487 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:17 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 1..369 37..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:53:34 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 1..369 37..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:31 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 1..369 37..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:51 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 1..369 37..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:19:55 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 1..369 37..405 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:42:58 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:16:38 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 15..419 1..405 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:53:34 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 15..437 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:31 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 15..437 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:51 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 15..419 1..405 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:19:55 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 15..437 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:59 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19466588..19466962 49..423 100 <- Minus
3L 19467018..19467065 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:59 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19466588..19466962 49..423 100 <- Minus
3L 19467018..19467065 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:59 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19466588..19466962 49..423 100 <- Minus
3L 19467018..19467065 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:31 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19459688..19460062 49..423 100 <- Minus
arm_3L 19460118..19460165 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:31:09 Download gff for IP20469.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19459688..19460062 49..423 100 <- Minus
3L 19460118..19460165 1..48 100   Minus

IP20469.hyp Sequence

Translation from 0 to 404

> IP20469.hyp
SFRTVSTRSIIIMFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPL
AYSAPAAVVAAPAPVVTATSSQVIARNYNGIAVAPVIAPVAAPVVAKYTA
APFAYASPLAYSAPLAYTSPLAYKTLPAAAPVLL*

IP20469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-PA 122 CG14096-PA 1..122 13..134 595 100 Plus
CG12519-PB 131 CG12519-PB 1..131 13..134 486 78.9 Plus
CG12519-PA 131 CG12519-PA 1..131 13..134 486 78.9 Plus
CG18294-PA 141 CG18294-PA 1..141 13..134 486 76.8 Plus
CG32214-PC 116 CG32214-PC 1..116 13..134 418 74.6 Plus

IP20469.pep Sequence

Translation from 0 to 404

> IP20469.pep
SFRTVSTRSIIIMFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPL
AYSAPAAVVAAPAPVVTATSSQVIARNYNGIAVAPVIAPVAAPVVAKYTA
APFAYASPLAYSAPLAYTSPLAYKTLPAAAPVLL*

IP20469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23675-PA 108 GF23675-PA 1..108 13..134 277 78.7 Plus
Dana\GF23677-PA 132 GF23677-PA 1..111 13..98 214 70.3 Plus
Dana\GF23676-PA 120 GF23676-PA 1..113 13..119 206 67.7 Plus
Dana\GF10759-PA 139 GF10759-PA 1..137 13..115 186 56.6 Plus
Dana\GF23674-PA 140 GF23674-PA 1..62 13..80 184 86.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13407-PA 135 GG13407-PA 1..126 13..117 303 63.5 Plus
Dere\GG13406-PA 105 GG13406-PA 1..96 13..117 285 69.9 Plus
Dere\GG16035-PA 121 GG16035-PA 1..112 13..117 277 62 Plus
Dere\GG13408-PA 155 GG13408-PA 15..155 2..134 266 76.6 Plus
Dere\GG16036-PA 119 GG16036-PA 1..119 13..134 187 84.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22599-PA 120 GH22599-PA 1..120 13..134 191 64.7 Plus
Dgri\GH22596-PA 120 GH22596-PA 1..120 13..134 191 64.7 Plus
Dgri\GH24646-PA 120 GH24646-PA 1..116 13..128 187 64.8 Plus
Dgri\GH22597-PA 126 GH22597-PA 1..122 13..128 185 66.1 Plus
Dgri\GH22598-PA 118 GH22598-PA 1..116 13..115 169 62.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-PA 122 CG14096-PA 1..122 13..134 595 100 Plus
CG12519-PB 131 CG12519-PB 1..131 13..134 486 78.9 Plus
CG12519-PA 131 CG12519-PA 1..131 13..134 486 78.9 Plus
CG18294-PA 141 CG18294-PA 1..141 13..134 486 76.8 Plus
CG32214-PC 116 CG32214-PC 1..116 13..134 418 74.6 Plus
CG32214-PB 116 CG32214-PB 1..116 13..134 418 74.6 Plus
825-Oak-PB 129 CG32208-PB 1..125 13..128 407 71 Plus
CG32213-PB 129 CG32213-PB 1..125 13..128 405 71 Plus
CG32212-PA 111 CG32212-PA 1..107 13..122 325 69.1 Plus
CG14095-PA 162 CG14095-PA 1..113 13..133 268 52.7 Plus
CG13678-PA 128 CG13678-PA 1..126 13..134 207 48.1 Plus
CG13674-PB 137 CG13674-PB 5..115 17..132 188 48 Plus
CG13674-PA 137 CG13674-PA 5..115 17..132 188 48 Plus
CG13068-PA 109 CG13068-PA 1..98 13..130 183 44.6 Plus
CG13679-PB 119 CG13679-PB 5..117 17..134 180 45.4 Plus
CG13044-PA 155 CG13044-PA 1..124 13..123 168 43.7 Plus
Cpr64Ad-PB 247 CG1259-PB 27..135 28..132 164 46.6 Plus
CG13069-PA 97 CG13069-PA 1..96 13..124 156 43.2 Plus
CG13047-PB 170 CG13047-PB 5..120 18..132 147 44.4 Plus
CG13049-PA 181 CG13049-PA 75..176 22..131 137 40 Plus
CG13066-PB 93 CG13066-PB 6..84 17..113 134 41.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11789-PA 104 GI11789-PA 1..99 13..120 234 63.5 Plus
Dmoj\GI13530-PA 164 GI13530-PA 31..97 9..80 150 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20932-PA 139 GL20932-PA 1..139 13..134 214 48.7 Plus
Dper\GL20934-PA 62 GL20934-PA 1..55 13..79 153 56.7 Plus
Dper\GL20665-PA 139 GL20665-PA 6..139 7..134 141 48.3 Plus
Dper\GL20933-PA 131 GL20933-PA 6..131 7..123 135 48.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28229-PA 126 GA28229-PA 1..126 13..134 184 57.9 Plus
Dpse\GA28230-PA 131 GA28230-PA 6..131 7..123 147 51.8 Plus
Dpse\GA28228-PA 131 GA28228-PA 6..131 7..123 147 51.8 Plus
Dpse\GA28232-PA 151 GA28232-PA 1..145 13..123 146 41 Plus
Dpse\GA28633-PA 187 GA28633-PA 1..56 13..80 146 69.1 Plus
Dpse\GA28633-PA 187 GA28633-PA 78..141 5..80 136 60.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18647-PA 94 GM18647-PA 30..94 70..134 194 92.3 Plus
Dsec\GM19525-PA 182 GM19525-PA 93..173 58..117 154 59.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12281-PA 135 GD12281-PA 1..135 13..134 318 83 Plus
Dsim\GD12284-PA 170 GD12284-PA 25..103 2..80 192 83.5 Plus
Dsim\GD14804-PA 151 GD14804-PA 25..142 2..117 141 65.3 Plus
Dsim\GD14802-PA 179 GD14802-PA 25..97 2..80 133 77.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13492-PA 122 GJ13492-PA 1..65 13..82 148 72.9 Plus
Dvir\GJ13493-PA 110 GJ13493-PA 1..103 13..120 138 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19523-PA 137 GK19523-PA 1..75 13..99 186 71.3 Plus
Dwil\GK19490-PA 142 GK19490-PA 1..126 13..123 182 54.3 Plus
Dwil\GK20201-PA 138 GK20201-PA 1..74 13..98 181 70.9 Plus
Dwil\GK19512-PA 138 GK19512-PA 1..122 13..123 179 53.6 Plus
Dwil\GK20211-PA 128 GK20211-PA 1..118 13..117 178 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22503-PA 130 GE22503-PA 1..130 13..134 230 83.1 Plus
Dyak\GE23008-PA 147 GE23008-PA 15..138 2..117 229 71.9 Plus
Dyak\GE15121-PA 142 GE15121-PA 15..142 2..134 224 71.9 Plus
Dyak\GE22502-PA 117 GE22502-PA 1..117 13..134 200 71.8 Plus
Dyak\GE22779-PA 124 GE22779-PA 1..124 13..134 192 79.2 Plus