Clone IP20474 Report

Search the DGRC for IP20474

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:74
Vector:pOT2
Associated Gene/TranscriptCG34033-RA
Protein status:IP20474.pep: gold
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34033 2008-05-05 Release 5.5 slip selected
CG34033 2008-08-15 Release 5.9 accounting
CG34033 2008-12-18 5.12 accounting

Clone Sequence Records

IP20474.complete Sequence

587 bp assembled on 2008-05-14

GenBank Submission: BT032940

> IP20474.complete
AAAGAAATGAGTCAAATACTACGCATGCTTTACTGTCTTCCCATTTGGCT
GCTGCTGCTTTTGCGTGCTGATGAGGCAAACGGTAAGGGCATATGCCTGT
ATTTCAGTGAAAAAACAGCTTCTTGGTTTAGTGCCCTGACCATCTGCAAA
AGCCTCCACATGTGCTTGGCTGATCTAAACACCGAAGTTACCCTATTCCA
GATGAAAAGCAAAATAAACCAAGACGACCACGAGTACTGGTTTGGATTGA
ATGCACACGATAAGCCCACCTACAGATACGTTTCGAACAACAAGTCCATT
GAGTACTCGCCGCACAATTCAAAGCTGGTGAACAACGAAGGATGCGTCTA
TGTTAAACAGCAAAACGACTTTTTCAAATTTGAATCGGCAAAGTGTCGCG
AACACCGGAGATTCATCTGTACTAAAACCGATGAATGCGATGGTGTTAGC
ATGAAACATGGAAACTCAAAATGCGTCATAACCGCAGAGGAAAGAGATCT
TGTAGCCTACTAACTTATAGTTTACTGCAGACAAATAAATGGTTTTTGGG
ACAGCATGAGCATAATAAAAAAAAAAAAAAAAAAAAA

IP20474.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34033-RA 661 CG34033-RA 96..661 1..566 2830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5708223..5708671 118..566 2245 100 Plus
chr2R 21145070 chr2R 5708048..5708165 1..118 590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9820738..9821187 118..567 2250 100 Plus
2R 25286936 2R 9820563..9820680 1..118 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9821937..9822386 118..567 2250 100 Plus
2R 25260384 2R 9821762..9821879 1..118 590 100 Plus
Blast to na_te.dros performed 2019-03-16 17:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dhet\Uhu 1658 Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). 41..69 548..518 105 87.1 Minus

IP20474.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:53:29 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5708048..5708164 1..117 100 -> Plus
chr2R 5708223..5708671 118..566 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:22 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:53 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:12 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:17 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:20:39 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:16:01 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:52 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..566 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:12 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..566 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:17 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..507 7..513 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:20:39 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
CG34033-RA 1..566 1..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:29 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9820563..9820679 1..117 100 -> Plus
2R 9820738..9821186 118..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:29 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9820563..9820679 1..117 100 -> Plus
2R 9820738..9821186 118..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:29 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9820563..9820679 1..117 100 -> Plus
2R 9820738..9821186 118..566 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:12 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5708068..5708184 1..117 100 -> Plus
arm_2R 5708243..5708691 118..566 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:42 Download gff for IP20474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9821762..9821878 1..117 100 -> Plus
2R 9821937..9822385 118..566 100   Plus

IP20474.hyp Sequence

Translation from 0 to 512

> IP20474.hyp
KEMSQILRMLYCLPIWLLLLLRADEANGKGICLYFSEKTASWFSALTICK
SLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLNAHDKPTYRYVSNNKSI
EYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICTKTDECDGVS
MKHGNSKCVITAEERDLVAY*

IP20474.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34033-PA 168 CG34033-PA 1..168 3..170 913 100 Plus

IP20474.pep Sequence

Translation from 0 to 512

> IP20474.pep
KEMSQILRMLYCLPIWLLLLLRADEANGKGICLYFSEKTASWFSALTICK
SLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLNAHDKPTYRYVSNNKSI
EYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICTKTDECDGVS
MKHGNSKCVITAEERDLVAY*

IP20474.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19837-PA 171 GF19837-PA 30..170 30..169 318 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24106-PA 167 GG24106-PA 19..167 22..170 649 77.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34033-PA 168 CG34033-PA 1..168 3..170 913 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17087-PA 176 GL17087-PA 4..148 5..149 284 40.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24357-PA 176 GA24357-PA 4..148 5..149 282 40.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21154-PA 168 GM21154-PA 1..168 3..170 753 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10686-PA 168 GD10686-PA 1..168 3..170 755 89.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21516-PA 181 GJ21516-PA 12..145 17..148 247 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19104-PA 144 GK19104-PA 3..143 42..169 194 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19304-PA 167 GE19304-PA 1..167 3..170 662 75 Plus