BDGP Sequence Production Resources |
Search the DGRC for IP20474
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 204 |
Well: | 74 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34033-RA |
Protein status: | IP20474.pep: gold |
Sequenced Size: | 587 |
Gene | Date | Evidence |
---|---|---|
CG34033 | 2008-05-05 | Release 5.5 slip selected |
CG34033 | 2008-08-15 | Release 5.9 accounting |
CG34033 | 2008-12-18 | 5.12 accounting |
587 bp assembled on 2008-05-14
GenBank Submission: BT032940
> IP20474.complete AAAGAAATGAGTCAAATACTACGCATGCTTTACTGTCTTCCCATTTGGCT GCTGCTGCTTTTGCGTGCTGATGAGGCAAACGGTAAGGGCATATGCCTGT ATTTCAGTGAAAAAACAGCTTCTTGGTTTAGTGCCCTGACCATCTGCAAA AGCCTCCACATGTGCTTGGCTGATCTAAACACCGAAGTTACCCTATTCCA GATGAAAAGCAAAATAAACCAAGACGACCACGAGTACTGGTTTGGATTGA ATGCACACGATAAGCCCACCTACAGATACGTTTCGAACAACAAGTCCATT GAGTACTCGCCGCACAATTCAAAGCTGGTGAACAACGAAGGATGCGTCTA TGTTAAACAGCAAAACGACTTTTTCAAATTTGAATCGGCAAAGTGTCGCG AACACCGGAGATTCATCTGTACTAAAACCGATGAATGCGATGGTGTTAGC ATGAAACATGGAAACTCAAAATGCGTCATAACCGCAGAGGAAAGAGATCT TGTAGCCTACTAACTTATAGTTTACTGCAGACAAATAAATGGTTTTTGGG ACAGCATGAGCATAATAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34033-RA | 661 | CG34033-RA | 96..661 | 1..566 | 2830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dhet\Uhu | 1658 | Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). | 41..69 | 548..518 | 105 | 87.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5708048..5708164 | 1..117 | 100 | -> | Plus |
chr2R | 5708223..5708671 | 118..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..566 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..566 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..507 | 7..513 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34033-RA | 1..566 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9820563..9820679 | 1..117 | 100 | -> | Plus |
2R | 9820738..9821186 | 118..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9820563..9820679 | 1..117 | 100 | -> | Plus |
2R | 9820738..9821186 | 118..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9820563..9820679 | 1..117 | 100 | -> | Plus |
2R | 9820738..9821186 | 118..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5708068..5708184 | 1..117 | 100 | -> | Plus |
arm_2R | 5708243..5708691 | 118..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9821762..9821878 | 1..117 | 100 | -> | Plus |
2R | 9821937..9822385 | 118..566 | 100 | Plus |
Translation from 0 to 512
> IP20474.hyp KEMSQILRMLYCLPIWLLLLLRADEANGKGICLYFSEKTASWFSALTICK SLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLNAHDKPTYRYVSNNKSI EYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICTKTDECDGVS MKHGNSKCVITAEERDLVAY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34033-PA | 168 | CG34033-PA | 1..168 | 3..170 | 913 | 100 | Plus |
Translation from 0 to 512
> IP20474.pep KEMSQILRMLYCLPIWLLLLLRADEANGKGICLYFSEKTASWFSALTICK SLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLNAHDKPTYRYVSNNKSI EYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICTKTDECDGVS MKHGNSKCVITAEERDLVAY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19837-PA | 171 | GF19837-PA | 30..170 | 30..169 | 318 | 38.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24106-PA | 167 | GG24106-PA | 19..167 | 22..170 | 649 | 77.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34033-PA | 168 | CG34033-PA | 1..168 | 3..170 | 913 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17087-PA | 176 | GL17087-PA | 4..148 | 5..149 | 284 | 40.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24357-PA | 176 | GA24357-PA | 4..148 | 5..149 | 282 | 40.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21154-PA | 168 | GM21154-PA | 1..168 | 3..170 | 753 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10686-PA | 168 | GD10686-PA | 1..168 | 3..170 | 755 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21516-PA | 181 | GJ21516-PA | 12..145 | 17..148 | 247 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19104-PA | 144 | GK19104-PA | 3..143 | 42..169 | 194 | 31.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19304-PA | 167 | GE19304-PA | 1..167 | 3..170 | 662 | 75 | Plus |