Clone IP20489 Report

Search the DGRC for IP20489

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:204
Well:89
Vector:pOT2
Associated Gene/TranscriptCG33225-RB
Protein status:IP20489.pep: gold
Sequenced Size:956

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33225 2008-05-05 Release 5.5 slip selected
CG33225 2008-08-15 Release 5.9 accounting
CG33225 2008-12-18 5.12 accounting

Clone Sequence Records

IP20489.complete Sequence

956 bp assembled on 2008-05-14

GenBank Submission: BT032941

> IP20489.complete
CTTATGTGAGTCCCATATAAAAGCATAGCGTATGGGCAATTAGCTCAGTT
TTCTTTACAACATGAAGATCTTCGTAGCTGAAATAGTGCTACTAGCGAGC
TTGGTCCTTGGCGCAAGACTAGGATCCAGCACCCTGCTAACGAATGATTG
CGGGACAACGAGGCACCCATCGAGAATTCGGCGGGTTGTTGGAGGTAACG
ATGCGGACAGGTTCGCCAACCCCTGGATGGTCATGGTGCTCGGAGAAAAC
AATGTCTTCTGCAGCGGTTCGCTAATCACTCGTCTTTTTGTCTTGACGTC
AGCGAGCTGCCTTTTATCGCTTCCCAAACAAGTGATCTTGGGCGAATACG
ACAGGAACTGCACTTCTGCGGATTGCACGTCCATCCGCCAAGTGATTGAT
ATCGATCAGAAGATTATCCATGGCCAATTCGGCTTGGAAACCGTCAAAAA
ATATGATATTGCGCTACTTCGATTGGCAAAGAAGGTGTCGATCTCAGACT
ACGTCAGACCAATTTGCCTGTCCGTCGATCGCCAAGTGGGACGTAGCGTT
CAACATTTCACTGCCACCGGCTGGGGCACTACCGAATGGAATGAACCCAG
CACCATTTTACAGACAGTCACACTAAGTAAAATCAATAGAAAGTATTGTA
AAGGCAGGCTAAGGCAGAATATCGATGCATCCCAGCTATGCGTTGGCGGT
CCAAGAAAGGACACTTGTAGTGGAGATGCTGGAGGCCCGCTGAGCTTAAC
GTTGAAGATCGATGGTGACGGCAAGTGGAATAATAAATCTCGGGCTTTTC
TCATCGGCATTGTCAGCTATGGTAGTTCATCTTGTAGTGGTATCGGTGTT
TACACAAATGTTGAGCACTATATGGATTGGATTGTAAGAACCATCAACAA
AAGCAATACAGAAAAAATTGCCAACGTCCATAGAAGTTAAAAAAAAAAAA
AAAAAA

IP20489.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33225-RB 1138 CG33225-RB 112..1051 1..940 4700 100 Plus
CG33225.a 1076 CG33225.a 117..989 68..940 4365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17477471..17477913 496..938 2200 99.8 Plus
chr2R 21145070 chr2R 17476801..17477087 1..284 1340 98.6 Plus
chr2R 21145070 chr2R 17477247..17477416 328..497 805 98.2 Plus
chr2R 21145070 chr2R 17477149..17477191 285..327 215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21591055..21591499 496..940 2225 100 Plus
2R 25286936 2R 21590386..21590669 1..284 1420 100 Plus
2R 25286936 2R 21590831..21591000 328..497 850 100 Plus
2R 25286936 2R 21590731..21590773 285..327 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21592254..21592698 496..940 2225 100 Plus
2R 25260384 2R 21591585..21591868 1..284 1420 100 Plus
2R 25260384 2R 21592030..21592199 328..497 850 100 Plus
2R 25260384 2R 21591930..21591972 285..327 215 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:30:00 has no hits.

IP20489.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:31:06 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17476801..17477087 1..284 98 -> Plus
chr2R 17477149..17477191 285..327 100 -> Plus
chr2R 17477247..17477416 328..497 98 -> Plus
chr2R 17477473..17477913 498..938 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:24 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..877 62..938 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:58:10 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..877 62..938 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:23 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..879 62..940 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:57:03 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RA 1..146 62..207 100 == Plus
CG33225-RA 147..760 325..938 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:05:05 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..879 62..940 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:09 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..938 1..938 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:58:10 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..938 1..938 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:23 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..892 47..938 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:57:03 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RA 1..146 62..207 100 == Plus
CG33225-RA 147..760 325..938 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:05 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
CG33225-RB 1..892 47..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:31:06 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21590831..21591000 328..497 100 -> Plus
2R 21590386..21590669 1..284 100 -> Plus
2R 21590731..21590773 285..327 100 -> Plus
2R 21591057..21591497 498..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:31:06 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21590831..21591000 328..497 100 -> Plus
2R 21590386..21590669 1..284 100 -> Plus
2R 21590731..21590773 285..327 100 -> Plus
2R 21591057..21591497 498..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:31:06 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21590831..21591000 328..497 100 -> Plus
2R 21590386..21590669 1..284 100 -> Plus
2R 21590731..21590773 285..327 100 -> Plus
2R 21591057..21591497 498..938 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:23 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17477891..17478174 1..284 100 -> Plus
arm_2R 17478236..17478278 285..327 100 -> Plus
arm_2R 17478336..17478505 328..497 100 -> Plus
arm_2R 17478562..17479002 498..938 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:18 Download gff for IP20489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21592030..21592199 328..497 100 -> Plus
2R 21591585..21591868 1..284 100 -> Plus
2R 21591930..21591972 285..327 100 -> Plus
2R 21592256..21592696 498..938 100   Plus

IP20489.pep Sequence

Translation from 61 to 939

> IP20489.pep
MKIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADR
FANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNC
TSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRP
ICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRL
RQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGI
VSYGSSSCSGIGVYTNVEHYMDWIVRTINKSNTEKIANVHRS*

IP20489.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12091-PA 280 GF12091-PA 1..270 1..284 380 35.1 Plus
Dana\GF11318-PA 308 GF11318-PA 1..220 56..284 380 37 Plus
Dana\GF13370-PA 505 GF13370-PA 6..281 22..282 347 32.9 Plus
Dana\GF11497-PA 284 GF11497-PA 1..281 1..283 329 34.7 Plus
Dana\GF23281-PA 372 GF23281-PA 105..367 29..278 321 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18032-PA 282 GG18032-PA 1..281 1..282 542 40.1 Plus
Dere\GG20038-PA 289 GG20038-PA 1..286 1..291 493 38.8 Plus
Dere\GG20772-PA 333 GG20772-PA 1..280 1..278 448 37.9 Plus
Dere\GG20540-PA 291 GG20540-PA 5..279 5..280 418 37.9 Plus
Dere\GG20542-PA 281 GG20542-PA 1..272 1..274 412 34.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20624-PA 374 GH20624-PA 113..370 40..280 333 32.8 Plus
Dgri\GH17524-PA 374 GH17524-PA 113..370 40..280 333 32.8 Plus
Dgri\GH19111-PA 344 GH19111-PA 82..342 41..278 325 34.5 Plus
Dgri\GH17456-PA 395 GH17456-PA 122..389 30..274 320 33.7 Plus
Dgri\GH20292-PA 242 GH20292-PA 2..236 52..275 310 34.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG33225-PB 292 CG33225-PB 1..292 1..292 1519 100 Plus
CG33225-PC 307 CG33225-PC 18..307 3..292 1509 100 Plus
CG30288-PC 282 CG30288-PC 1..280 1..284 514 39.6 Plus
CG30414-PC 305 CG30414-PC 8..294 11..278 490 39.5 Plus
CG30414-PB 305 CG30414-PB 8..294 11..278 490 39.5 Plus
CG14227-PB 286 CG14227-PB 3..277 2..274 468 38.5 Plus
CG30289-PA 316 CG30289-PA 1..271 1..274 454 38.1 Plus
CG30090-PA 291 CG30090-PA 5..281 5..283 446 38.7 Plus
CG30283-PB 273 CG30283-PB 5..270 2..281 424 34.9 Plus
CG30287-PA 284 CG30287-PA 7..277 7..274 420 35.8 Plus
CG30082-PB 280 CR30082-PB 4..272 3..275 413 36 Plus
CG30088-PB 281 CG30088-PB 12..279 8..282 397 34.4 Plus
CG33226-PC 292 CG33226-PC 13..282 10..274 396 37.1 Plus
CG30091-PA 526 CG30091-PA 6..285 9..286 392 33.1 Plus
CG43336-PA 279 CG43336-PA 16..276 20..279 382 35.2 Plus
CG30187-PE 489 CG30187-PE 18..270 20..284 381 34.2 Plus
CG30187-PF 500 CG30187-PF 18..270 20..284 381 34.2 Plus
CG33459-PA 284 CG33459-PA 7..275 10..277 380 34.5 Plus
CG30087-PA 277 CG30087-PA 1..274 1..278 365 31.6 Plus
CG33458-PA 281 CG33458-PA 7..275 10..278 361 34.3 Plus
CG10764-PA 523 CG10764-PA 26..268 26..282 353 34.1 Plus
CG43335-PA 281 CG43335-PA 5..278 6..280 351 31.6 Plus
CG43110-PA 483 CG43110-PA 17..268 19..288 347 30 Plus
CG43110-PB 483 CG43110-PB 17..268 19..288 347 30 Plus
CG43742-PB 474 CG43742-PB 34..260 41..281 343 36.5 Plus
CG30083-PB 279 CG30083-PB 18..260 23..279 342 32.5 Plus
CG30286-PB 277 CG30286-PB 4..276 8..282 326 28.6 Plus
CG18636-PA 349 CG18636-PA 24..280 21..276 323 33.2 Plus
MP1-PA 390 CG1102-PA 127..388 41..278 323 34.7 Plus
MP1-PC 399 CG1102-PC 136..397 41..278 323 34.7 Plus
MP1-PE 400 CG1102-PE 137..398 41..278 323 34.7 Plus
CG30002-PB 311 CG30002-PB 33..302 17..275 321 36 Plus
SPE-PA 400 CG16705-PA 134..394 41..274 314 33.2 Plus
CG30098-PA 264 CG30098-PA 8..259 8..278 311 31.5 Plus
grass-PA 335 CG5896-PA 68..330 29..278 310 30.8 Plus
grass-PB 377 CG5896-PB 110..372 29..278 310 30.8 Plus
CG1773-PA 317 CG1773-PA 36..317 20..291 306 33.1 Plus
CG33461-PB 287 CG33461-PB 10..283 8..279 303 30 Plus
Sp7-PF 391 CG3066-PF 136..389 41..278 300 32.8 Plus
Sp7-PE 391 CG3066-PE 136..389 41..278 300 32.8 Plus
Sp7-PA 391 CG3066-PA 136..389 41..278 300 32.8 Plus
CG11836-PI 281 CG11836-PI 35..275 29..284 297 34.5 Plus
CG11836-PJ 333 CG11836-PJ 87..327 29..284 297 34.5 Plus
CG9733-PB 417 CG9733-PB 160..415 41..278 293 33.2 Plus
CG9733-PA 418 CG9733-PA 161..416 41..278 293 33.2 Plus
CG31219-PB 345 CG31219-PB 88..339 41..274 288 33.5 Plus
CG18420-PA 299 CG18420-PA 6..272 3..282 279 31.8 Plus
CG10232-PD 509 CG10232-PD 243..503 25..274 278 32.4 Plus
CG33462-PA 300 CG33462-PA 20..275 21..280 277 29.4 Plus
CG4914-PA 374 CG4914-PA 119..361 30..275 275 35.2 Plus
CG3700-PA 360 CG3700-PA 102..353 42..274 269 34.1 Plus
CG30091-PA 526 CG30091-PA 309..520 45..274 183 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23202-PA 376 GI23202-PA 116..373 40..280 337 33.1 Plus
Dmoj\GI22780-PA 412 GI22780-PA 145..410 41..278 309 32.2 Plus
Dmoj\GI10853-PA 285 GI10853-PA 22..283 41..278 300 32.6 Plus
Dmoj\GI16576-PA 502 GI16576-PA 240..501 30..281 295 31.4 Plus
Dmoj\GI24127-PA 389 GI24127-PA 136..387 41..278 294 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11857-PA 283 GL11857-PA 1..278 1..280 484 37.4 Plus
Dper\GL11321-PA 284 GL11321-PA 1..282 1..283 438 36.5 Plus
Dper\GL17488-PA 282 GL17488-PA 1..273 1..274 436 36.8 Plus
Dper\GL16656-PA 282 GL16656-PA 1..280 1..283 423 36.1 Plus
Dper\GL11858-PA 345 GL11858-PA 1..292 1..288 423 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15642-PA 283 GA15642-PA 1..278 1..280 483 37.4 Plus
Dpse\GA24176-PA 282 GA24176-PA 1..273 1..274 443 37.3 Plus
Dpse\GA24684-PA 282 GA24684-PA 9..280 8..283 425 37.3 Plus
Dpse\GA24175-PB 304 GA24175-PB 53..289 41..285 422 37.8 Plus
Dpse\GA24685-PA 284 GA24685-PA 18..282 21..283 416 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15552-PA 269 GM15552-PA 26..269 28..283 562 45.7 Plus
Dsec\GM22717-PA 299 GM22717-PA 3..290 2..274 470 36.9 Plus
Dsec\GM15716-PA 251 GM15716-PA 2..246 23..278 454 39.5 Plus
Dsec\GM15551-PA 287 GM15551-PA 1..272 1..278 444 37.7 Plus
Dsec\GM21631-PA 291 GM21631-PA 19..287 20..289 436 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12740-PA 296 GD12740-PA 1..291 1..287 1145 75.3 Plus
Dsim\GD25055-PA 269 GD25055-PA 26..269 28..283 561 45.7 Plus
Dsim\GD24450-PA 284 GD24450-PA 3..275 2..274 488 38.6 Plus
Dsim\GD25193-PA 278 GD25193-PA 2..253 23..278 447 39.5 Plus
Dsim\GD11133-PA 295 GD11133-PA 19..287 20..289 432 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21978-PA 296 GJ21978-PA 44..292 41..278 367 36.6 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 112..370 40..281 363 34.3 Plus
Dvir\GJ21214-PA 280 GJ21214-PA 12..277 21..278 356 35.5 Plus
Dvir\GJ21212-PA 268 GJ21212-PA 2..265 23..278 342 33.5 Plus
Dvir\GJ14460-PA 396 GJ14460-PA 133..394 41..278 327 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11884-PA 375 GK11884-PA 116..370 41..278 325 33.7 Plus
Dwil\GK10951-PA 391 GK10951-PA 128..389 41..278 319 33.2 Plus
Dwil\GK22647-PA 279 GK22647-PA 27..277 41..278 298 31.4 Plus
Dwil\GK23933-PA 280 GK23933-PA 6..253 41..274 298 32.8 Plus
Dwil\GK12018-PA 384 GK12018-PA 129..382 41..278 293 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12203-PA 262 GE12203-PA 1..240 1..282 811 56.9 Plus
Dyak\GE11574-PA 456 GE11574-PA 2..277 1..282 510 40.6 Plus
Dyak\GE13709-PA 276 GE13709-PA 1..271 1..281 509 41.6 Plus
Dyak\GE13708-PA 311 GE13708-PA 4..274 6..278 472 40.9 Plus
Dyak\GE13702-PA 297 GE13702-PA 1..281 1..284 461 35.2 Plus
Dyak\GE11574-PA 456 GE11574-PA 278..456 90..281 378 42.7 Plus

IP20489.hyp Sequence

Translation from 61 to 937

> IP20489.hyp
MKIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADR
FANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNC
TSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRP
ICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRL
RQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGI
VSYGSSSCSGIGVYTNVEHYMDWIVRTINKSNTEKIANVHRS

IP20489.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33225-PB 292 CG33225-PB 1..292 1..292 1519 100 Plus
CG33225-PC 307 CG33225-PC 18..307 3..292 1509 100 Plus
CG30288-PC 282 CG30288-PC 1..280 1..284 514 39.6 Plus
CG30414-PC 305 CG30414-PC 8..294 11..278 490 39.5 Plus
CG30414-PB 305 CG30414-PB 8..294 11..278 490 39.5 Plus