Clone IP20522 Report

Search the DGRC for IP20522

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:22
Vector:pOT2
Associated Gene/TranscriptCG15577-RA
Protein status:IP20522.pep: gold
Sequenced Size:526

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15577 2008-04-29 Release 5.5 accounting
CG15577 2008-05-05 Release 5.5 slip selected
CG15577 2008-08-15 Release 5.9 accounting
CG15577 2008-12-18 5.12 accounting

Clone Sequence Records

IP20522.complete Sequence

526 bp assembled on 2008-05-14

GenBank Submission: BT031071

> IP20522.complete
CCCGGCGAGTCGGTCGCAAAATTTGTCTACACATTTGGTTTCCAAAAAAG
GAATATAAAAAAGTCAACAAAAAAAATGTAAAAAATTTTACTACCATGCC
CGTCACCTACAGGACTCGCACACTGCCGCAACAGCGGAAGTTGGTCCCCA
ACCTACTGAGGTCCATACTACGCGTCCTGGAGGAGACGCGCCGACCCATG
AGTGACAAAGAGTTGAACTTCGTCCTGGGCGTCCAGTACCGACGCAACGA
TCCGGAGTTCTATCGCCAAGTGCAAGTCAACCTGCGCGATGGCGTCGAAT
ACGGCATTCTGAAACGCCAGGGAAACCAGTTTTCGCTGCGATCCCGACGC
CTTGGTGAACTGATGTCTACTCTTGGATCCTCGCCAAACCGCTAAACTTT
GGGAAACCGCCAAGCCTACAGATATTAAGAATACCCCGAAACAGAGCGTA
CACGAACAGAATATAACAAAAGCTCCTGGAAATTAATTAGAGTCCTTAAC
AGAATAGAGAAAAAAAAAAAAAAAAA

IP20522.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-RA 508 CG15577-RA 1..508 1..509 2505 99.8 Plus
CG15578-RA 415 CG15578-RA 135..334 140..339 475 82.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4169552..4170059 509..1 2450 99.2 Minus
chrX 22417052 chrX 4170687..4170886 339..140 475 82.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4276491..4277000 511..1 2505 99.8 Minus
X 23542271 X 4277628..4277827 339..140 475 82.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4284589..4285098 511..1 2515 99.8 Minus
X 23527363 X 4285726..4285925 339..140 475 82.5 Minus
Blast to na_te.dros performed on 2019-03-15 16:32:20 has no hits.

IP20522.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:36 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4169552..4170059 1..509 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:31 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:51:59 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:17:52 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:10 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:56 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:14:53 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:51:59 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..508 1..509 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:17:52 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..508 1..509 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:11 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..300 96..395 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:56 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..508 1..509 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:36 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
X 4276493..4277000 1..509 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:36 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
X 4276493..4277000 1..509 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:36 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
X 4276493..4277000 1..509 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:17:52 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4170526..4171033 1..509 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:02 Download gff for IP20522.complete
Subject Subject Range Query Range Percent Splice Strand
X 4284591..4285098 1..509 99   Minus

IP20522.pep Sequence

Translation from 2 to 394

> IP20522.pep
RRVGRKICLHIWFPKKEYKKVNKKNVKNFTTMPVTYRTRTLPQQRKLVPN
LLRSILRVLEETRRPMSDKELNFVLGVQYRRNDPEFYRQVQVNLRDGVEY
GILKRQGNQFSLRSRRLGELMSTLGSSPNR*

IP20522.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21481-PA 100 GF21481-PA 1..93 32..124 368 77.4 Plus
Dana\GF20789-PA 164 GF20789-PA 12..84 45..117 134 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18551-PA 99 GG18551-PA 1..99 32..130 431 85.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24284-PA 144 GH24284-PA 42..115 45..118 137 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-PA 99 CG15577-PA 1..99 32..130 502 100 Plus
CG15578-PA 89 CG15578-PA 7..78 40..112 254 68.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16135-PA 102 GI16135-PA 1..99 32..130 243 50.5 Plus
Dmoj\GI16408-PA 128 GI16408-PA 12..79 45..112 139 42.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14189-PA 92 GL14189-PA 3..87 43..127 261 57.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13823-PA 101 GA13823-PA 1..95 32..126 288 56.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12697-PA 99 GM12697-PA 1..99 32..130 477 93.9 Plus
Dsec\GM12696-PA 85 GM12696-PA 4..71 50..117 221 63.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24601-PA 99 GD24601-PA 1..99 32..130 480 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17028-PA 131 GJ17028-PA 12..84 45..117 134 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17523-PA 99 GK17523-PA 1..94 32..125 288 59.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16864-PA 99 GE16864-PA 1..99 32..130 448 87.9 Plus

IP20522.hyp Sequence

Translation from 95 to 394

> IP20522.hyp
MPVTYRTRTLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRR
NDPEFYRQVQVNLRDGVEYGILKRQGNQFSLRSRRLGELMSTLGSSPNR*

IP20522.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-PA 99 CG15577-PA 1..99 1..99 502 100 Plus
CG15578-PA 89 CG15578-PA 7..78 9..81 254 68.5 Plus