Clone IP20524 Report

Search the DGRC for IP20524

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:24
Vector:pOT2
Protein status:IP20524.pep: Imported from assembly
Sequenced Size:966

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34040 2008-05-05 Release 5.5 slip selected
CG34040 2008-08-15 Release 5.9 accounting
CG34040 2008-12-18 5.12 accounting

Clone Sequence Records

IP20524.complete Sequence

966 bp assembled on 2008-05-14

GenBank Submission: BT032744

> IP20524.complete
GTCAAACTTCAATTGTTCTAAACTCTTGGTCGCACTTGTGTTGACCAGCA
GCTACGTTTTGGCATCAGAAAAGTGCATTTATTGTCGGGATATAAACTGC
CAAAGGAGCAGCTATGATGCGGATGAACAATGCTCAGAGAAGTTGGATGC
CTGCGTTAGTGTTTTTAAGGCAGGCGTAATTCAGGCCCAAGGATGTCTGG
AAAGTCTCGAAGATGATTGGCGAGAAAAATGCGAGGATAAAGATAAAGGA
AATGAAATCGATTGCGAGATATGTGTAACCGAAAGATGCAACAACGTCGC
AGCCAAAAGGACTAGCTGTATTCAGTGCAACAATACAGAGGACGCACAGT
GTGCTGAATCTCCCGGGCTACTAACGGCTGTACAATGTCCTATTGCTAGA
TCTGGCAGAAGTTTTTGCTATGCCAGTTTGGTTGGAGACGATTTGAAAAG
GGGGTGCTCCCTGACTCTTTCAGATCAAGTCAAATGCCTGGCTGATCCAA
ATTGCCACTTGTGCGATCCTTTGGAACAACCACACTGCAATGATCAAATT
GTAAGGGCAGATGATTCACCAACCACCACTCAGGAACCGACGGAATCTAC
AAGTTCTTCAACGGAGTCCACGCCTAGTTCAACAATGACAACTGAATCAT
CATCAAGTTCACCAGAAAGTTCAACAACAAGTTCAACAACAAATTCACCA
GAAACTACACAATCCACCACAGAACCTTCGACAACCGAAGAGGTTCCAAC
CACAACCGATAAACCCAATTCGGCATTCGGTTTGCATGCTTCCGTATTGC
TGATCTTTGCCCAATTGGCTTTGTGCTTTTATAAGCCACTTTAATGGGCA
AAGTGACGGCGCTTAACCATAATTCCCACGGACTTCTCTACTCTATGTGC
GACATTATTAAAGTAATTTTTATGACGTGACCATAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

IP20524.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34040-RA 1001 CG34040-RA 47..983 1..937 4670 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17718907..17719502 934..339 2965 99.8 Minus
chr2R 21145070 chr2R 17719571..17719911 341..1 1705 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21832498..21833096 937..339 2980 99.8 Minus
2R 25286936 2R 21833165..21833505 341..1 1705 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21833697..21834295 937..339 2980 99.8 Minus
2R 25260384 2R 21834364..21834704 341..1 1705 100 Minus
Blast to na_te.dros performed 2019-03-16 00:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3279..3372 633..724 115 62.9 Plus

IP20524.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:26:12 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17718907..17719500 341..934 92 <- Minus
chr2R 17719572..17719911 1..340 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:36 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:58:06 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:36 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:55 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:00:23 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:22:03 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:58:06 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..936 1..934 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:36 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 47..980 1..934 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:56 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:00:23 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
CG34040-RA 47..980 1..934 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:12 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21832501..21833094 341..934 99 <- Minus
2R 21833166..21833505 1..340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:12 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21832501..21833094 341..934 99 <- Minus
2R 21833166..21833505 1..340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:12 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21832501..21833094 341..934 99 <- Minus
2R 21833166..21833505 1..340 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:36 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17720006..17720599 341..934 99 <- Minus
arm_2R 17720671..17721010 1..340 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:15 Download gff for IP20524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21833700..21834293 341..934 99 <- Minus
2R 21834365..21834704 1..340 100   Minus

IP20524.hyp Sequence

Translation from 0 to 843

> IP20524.hyp
SNFNCSKLLVALVLTSSYVLASEKCIYCRDINCQRSSYDADEQCSEKLDA
CVSVFKAGVIQAQGCLESLEDDWREKCEDKDKGNEIDCEICVTERCNNVA
AKRTSCIQCNNTEDAQCAESPGLLTAVQCPIARSGRSFCYASLVGDDLKR
GCSLTLSDQVKCLADPNCHLCDPLEQPHCNDQIVRADDSPTTTQEPTEST
SSSTESTPSSTMTTESSSSSPESSTTSSTTNSPETTQSTTEPSTTEEVPT
TTDKPNSAFGLHASVLLIFAQLALCFYKPL*

IP20524.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34040-PA 281 CG34040-PA 2..281 1..280 1482 100 Plus
CG4363-PA 199 CG4363-PA 13..180 10..180 314 35.3 Plus
CG4377-PA 231 CG4377-PA 34..186 22..173 286 36.3 Plus
CG13492-PD 2979 CG13492-PD 1538..1772 25..255 172 28 Plus
CG15347-PA 214 CG15347-PA 5..173 8..172 151 25.6 Plus

IP20524.pep Sequence

Translation from 1 to 843

> IP20524.pep
SNFNCSKLLVALVLTSSYVLASEKCIYCRDINCQRSSYDADEQCSEKLDA
CVSVFKAGVIQAQGCLESLEDDWREKCEDKDKGNEIDCEICVTERCNNVA
AKRTSCIQCNNTEDAQCAESPGLLTAVQCPIARSGRSFCYASLVGDDLKR
GCSLTLSDQVKCLADPNCHLCDPLEQPHCNDQIVRADDSPTTTQEPTEST
SSSTESTPSSTMTTESSSSSPESSTTSSTTNSPETTQSTTEPSTTEEVPT
TTDKPNSAFGLHASVLLIFAQLALCFYKPL*

IP20524.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11614-PA 231 GF11614-PA 2..172 1..170 568 63.7 Plus
Dana\GF11610-PA 225 GF11610-PA 33..180 24..173 281 41.4 Plus
Dana\GF11611-PA 199 GF11611-PA 30..180 25..180 270 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20741-PA 309 GG20741-PA 16..308 15..280 1051 74.8 Plus
Dere\GG20740-PA 199 GG20740-PA 30..180 25..180 265 36.5 Plus
Dere\GG20739-PA 231 GG20739-PA 36..186 24..173 242 36.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20774-PA 273 GH20774-PA 15..183 13..182 530 55.9 Plus
Dgri\GH20773-PA 203 GH20773-PA 28..193 25..189 246 33.7 Plus
Dgri\GH20772-PA 222 GH20772-PA 9..204 8..195 236 32.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34040-PA 281 CG34040-PA 2..281 1..280 1482 100 Plus
CG4363-PA 199 CG4363-PA 13..180 10..180 314 35.3 Plus
CG4377-PA 231 CG4377-PA 34..186 22..173 286 36.3 Plus
CG13492-PD 2979 CG13492-PD 1538..1772 25..255 172 28 Plus
CG15347-PA 214 CG15347-PA 5..173 8..172 151 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20858-PA 271 GI20858-PA 11..183 8..182 540 60.6 Plus
Dmoj\GI20856-PA 201 GI20856-PA 28..189 25..187 247 34.5 Plus
Dmoj\GI20855-PA 221 GI20855-PA 30..179 21..173 242 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17512-PA 237 GL17512-PA 26..179 23..178 493 55.8 Plus
Dper\GL17510-PA 228 GL17510-PA 37..194 24..180 229 33.3 Plus
Dper\GL17511-PA 196 GL17511-PA 27..177 25..180 227 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24185-PA 285 GA24185-PA 26..281 23..277 645 51 Plus
Dpse\GA18144-PA 228 GA18144-PA 37..194 24..180 229 33.3 Plus
Dpse\GA18134-PA 196 GA18134-PA 27..177 25..180 227 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15684-PA 289 GM15684-PA 2..288 1..280 1021 82.2 Plus
Dsec\GM15682-PA 231 GM15682-PA 34..186 22..173 247 36.9 Plus
Dsec\GM15683-PA 199 GM15683-PA 30..180 25..180 240 35.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25163-PA 281 GD25163-PA 2..280 1..280 1118 91.8 Plus
Dsim\GD25161-PA 231 GD25161-PA 34..186 22..173 244 36.3 Plus
Dsim\GD25162-PA 199 GD25162-PA 30..180 25..180 240 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20593-PA 279 GJ20593-PA 5..197 4..198 578 57.7 Plus
Dvir\GJ20591-PA 201 GJ20591-PA 28..189 25..187 273 35.8 Plus
Dvir\GJ20590-PA 222 GJ20590-PA 34..183 25..178 245 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19090-PA 255 GK19090-PA 2..255 1..276 448 41.8 Plus
Dwil\GK15646-PA 197 GK15646-PA 28..185 25..187 257 32.5 Plus
Dwil\GK15645-PA 209 GK15645-PA 3..169 7..173 240 35.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13673-PA 310 GE13673-PA 2..309 1..280 1021 72.8 Plus
Dyak\GE13671-PA 231 GE13671-PA 36..186 24..173 245 36.8 Plus
Dyak\GE13672-PA 199 GE13672-PA 30..180 25..180 229 35.9 Plus