Clone IP20531 Report

Search the DGRC for IP20531

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:31
Vector:pOT2
Associated Gene/TranscriptCG15456-RA
Protein status:IP20531.pep: gold
Sequenced Size:497

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15456 2008-05-05 Release 5.5 slip selected
CG15456 2008-12-18 5.12 accounting

Clone Sequence Records

IP20531.complete Sequence

497 bp assembled on 2008-12-10

GenBank Submission: BT053711.1

> IP20531.complete
ATGGTGAAGCGCTGATTTGATGTACGTTTTGATTTTGGAATACTTTTATG
TAATGGTGAAAGTGGAGGTGGAATACTGCGGCATCTGCAACTTTAGCGGG
CAGTGCCACCTGCTGCGCGAGTTCCTGCTGGCCTCGTCGCCCGACTTGGA
CATATCCTGTCGCACGGGACGGCGGGGATCCTTCGAGGTGTCCATCGACG
GTCAGCTAGTGCACTCGAAGCTTTCCTGCCTGGCATTTCCCCAGCACGCG
AGTGTCCTGGCCCAAGTGCAGAAGGCGGAGCGTGGAGAGCCCGTGGAGAA
AGTCCTGGAGCAGCCCATCAAGGACTGCGTCGTGATGTGATCTCCTACTT
TCACGCCTAGACTGTTTAAACACGATAGCTTCACGCTTACACCAACATTT
GTGGAACCCATTTGAAATCCTGTGATATATGGTATATACATATATAATAA
TAAATATAACATTATAATGCTCTCCTTAAAAAAAAAAAAAAAAAAAA

IP20531.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15456.b 512 CG15456.b 36..512 1..477 2385 100 Plus
CG15456-RA 511 CG15456-RA 35..511 1..477 2385 100 Plus
CG15456.a 535 CG15456.a 36..466 1..431 2155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20292019..20292418 477..78 2000 100 Minus
chrX 22417052 chrX 20292475..20292552 78..1 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20426508..20426908 478..78 2005 100 Minus
X 23542271 X 20426965..20427042 78..1 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20411600..20412000 478..78 2005 100 Minus
X 23527363 X 20412057..20412134 78..1 390 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:03:40 has no hits.

IP20531.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:04:45 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20292019..20292417 79..477 100 <- Minus
chrX 20292475..20292552 1..78 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:01 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..288 53..340 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:02 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..288 53..340 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:00:36 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..288 53..340 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:57 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..288 53..340 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 09:42:47 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..288 53..340 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:02 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 36..512 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:00:36 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:57 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15456-RA 1..477 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:45 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
X 20426509..20426907 79..477 100 <- Minus
X 20426965..20427042 1..78 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:45 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
X 20426509..20426907 79..477 100 <- Minus
X 20426965..20427042 1..78 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:45 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
X 20426509..20426907 79..477 100 <- Minus
X 20426965..20427042 1..78 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:00:36 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20297536..20297934 79..477 100 <- Minus
arm_X 20297992..20298069 1..78 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:43 Download gff for IP20531.complete
Subject Subject Range Query Range Percent Splice Strand
X 20411601..20411999 79..477 100 <- Minus
X 20412057..20412134 1..78 100   Minus

IP20531.pep Sequence

Translation from 19 to 339

> IP20531.pep
MYVLILEYFYVMVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTG
RRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGEPVEKVLEQPI
KDCVVM*

IP20531.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19209-PA 95 GF19209-PA 1..95 12..106 414 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17990-PA 95 GG17990-PA 1..95 12..106 479 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17729-PA 95 GH17729-PA 1..95 12..106 332 62.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15456-PB 95 CG15456-PB 1..95 12..106 494 100 Plus
CG15456-PA 95 CG15456-PA 1..95 12..106 494 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15477-PA 95 GI15477-PA 1..95 12..106 355 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15792-PA 96 GL15792-PA 1..96 12..106 340 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13743-PA 96 GA13743-PA 1..96 12..106 337 65.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22669-PA 95 GM22669-PA 1..95 12..106 478 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19189-PA 95 GJ19189-PA 1..95 12..106 364 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25426-PA 95 GK25426-PA 1..95 12..106 339 65.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15347-PA 95 GE15347-PA 1..95 12..106 467 92.6 Plus

IP20531.hyp Sequence

Translation from 19 to 339

> IP20531.hyp
MYVLILEYFYVMVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTG
RRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGEPVEKVLEQPI
KDCVVM*

IP20531.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15456-PB 95 CG15456-PB 1..95 12..106 494 100 Plus
CG15456-PA 95 CG15456-PA 1..95 12..106 494 100 Plus