Clone IP20534 Report

Search the DGRC for IP20534

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:34
Vector:pOT2
Associated Gene/TranscriptCG17650-RA
Protein status:IP20534.pep: gold
Sequenced Size:652

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17650 2008-05-05 Release 5.5 slip selected
CG17650 2008-08-15 Release 5.9 accounting
CG17650 2008-12-18 5.12 accounting

Clone Sequence Records

IP20534.complete Sequence

652 bp assembled on 2008-05-22

GenBank Submission: BT032745

> IP20534.complete
GTTAATCGAAGCCTCTCAGCAGGCCCTTGATTTTATCATCGATAGTTTAA
CATGCTGGAAAATTGGTGAAAAGAGTCAGGTCGTAGCAAAATGAGTGATT
TGGTAGGTATCGTTTATAATGACTATCCCATGGAGAGCGAGGAGGATTTC
AATAGGCGCAGGAGGGATCTTGATAATATATTTTTCAACTGCAGCACAAG
GAAAAATCAGGAACAACAATTCGAAGCCAAGCGTCCCATACTAAACTCAT
CGAACTACAATAAGATATTCGGAGCATCTTTGGGAGATGACATGGACTTC
GAGGACTTTCCCGACCTCAACCAACCACTGCCAAATATTTCCATTCACGA
GCAACTGCGTCTGGCTTCCGGGAACCGCGAGATAATCGCGAGCATTCAGC
GAAATCACCAAAAGCGACTCGAAAACCTTTGGCACTCGGAACTAATAGAA
AAACTAGCGCAAGAGTAAAAGCAATTCTAGTTAGAGATAGAAGTTGCTTT
TGGGTTTTCCTTCAGAGATTTCTCACAAAAAATATTAAATAAAATGTATT
GGTAAAGCCCTGATTACCATGTAAGTTGTTACCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

IP20534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG17650-RA 636 CG17650-RA 50..636 1..587 2935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1758095..1758468 583..209 1810 99.5 Minus
chr2L 23010047 chr2L 1758740..1758950 211..1 1040 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1758282..1758660 587..209 1895 100 Minus
2L 23513712 2L 1758932..1759142 211..1 1055 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1758282..1758660 587..209 1895 100 Minus
2L 23513712 2L 1758932..1759142 211..1 1055 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:18:33 has no hits.

IP20534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:36 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1758095..1758466 211..583 99 <- Minus
chr2L 1758741..1758950 1..210 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:38 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..378 91..468 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:21 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..378 91..468 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:52 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..378 91..468 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:13 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..378 91..468 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:03 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..378 91..468 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:39 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..519 65..583 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:21 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..519 65..583 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:52 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..534 50..583 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:13 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..519 65..583 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:03 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17650-RA 1..534 50..583 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:36 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1758286..1758658 211..583 100 <- Minus
2L 1758933..1759142 1..210 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:36 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1758286..1758658 211..583 100 <- Minus
2L 1758933..1759142 1..210 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:36 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1758286..1758658 211..583 100 <- Minus
2L 1758933..1759142 1..210 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:52 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1758933..1759142 1..210 100   Minus
arm_2L 1758286..1758658 211..583 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:00 Download gff for IP20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1758933..1759142 1..210 100   Minus
2L 1758286..1758658 211..583 100 <- Minus

IP20534.pep Sequence

Translation from 90 to 467

> IP20534.pep
MSDLVGIVYNDYPMESEEDFNRRRRDLDNIFFNCSTRKNQEQQFEAKRPI
LNSSNYNKIFGASLGDDMDFEDFPDLNQPLPNISIHEQLRLASGNREIIA
SIQRNHQKRLENLWHSELIEKLAQE*

IP20534.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24574-PA 139 GG24574-PA 1..132 1..123 308 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17650-PA 125 CG17650-PA 1..125 1..125 655 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16593-PA 126 GM16593-PA 1..126 1..125 504 78.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22894-PA 126 GD22894-PA 1..126 1..125 513 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15423-PA 133 GE15423-PA 1..133 1..124 384 60.9 Plus

IP20534.hyp Sequence

Translation from 90 to 467

> IP20534.hyp
MSDLVGIVYNDYPMESEEDFNRRRRDLDNIFFNCSTRKNQEQQFEAKRPI
LNSSNYNKIFGASLGDDMDFEDFPDLNQPLPNISIHEQLRLASGNREIIA
SIQRNHQKRLENLWHSELIEKLAQE*

IP20534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17650-PA 125 CG17650-PA 1..125 1..125 655 100 Plus