Clone IP20553 Report

Search the DGRC for IP20553

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:53
Vector:pOT2
Associated Gene/TranscriptCG13947-RA
Protein status:IP20553.pep: Inserted from web
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13947 2008-05-05 Release 5.5 slip selected
CG13947 2008-08-15 Release 5.9 accounting
CG13947 2008-12-18 5.12 accounting

Clone Sequence Records

IP20553.complete Sequence

465 bp assembled on 2008-12-12

GenBank Submission: BT032946

> IP20553.complete
TTCCTTCATCATCATCGCCCTCTTCGCACTGATTGCCGTGGCTGCCGCTC
AAGGTGGACCCCAGGGCGGACCTCAGGGTGGACCTCAGGGTGGACCTCAA
GGTGGACCACAGGGCGGACCCCAGGGTGGACCTCAAGGTGGACCCCAGGG
TGGTCCTCAGGGAGGACCCCAGGGTGGACCGCAGGGAGGACCCCAGGGTG
GTCCTGGTGGACCCGGTGGACCCGGGGGACCGTGGGGACTGCCTCCAAAT
GCCACTCTTCCCAGCAACAGCACTACCACCACCACCACTTCAACGACCAC
CGAATCCAGCACCAGCACAACCACGGAAGCCAGCACCGAGTCATCCCCTG
CTTAAGGCGCAGGACTCCAGCCAATCTAAAATCCATTTTTGGCTTGTTCT
CTTCCGCGCTTTCCTCGATATTAATAAAAGTCTTTTCTGCAAAAAGTAAA
AAAAAAAAAAAAAAA

IP20553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13947-RA 360 CG13947-RA 6..360 1..355 1775 100 Plus
CG12506-RA 446 CG12506-RA 26..106 1..81 210 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 779068..779523 1..447 2080 97.6 Plus
chr2L 23010047 chr2L 779115..779244 72..201 410 87.7 Plus
chr2L 23010047 chr2L 779115..779224 96..205 385 90 Plus
chr2L 23010047 chr2L 779163..779272 48..157 385 90 Plus
chr2L 23010047 chr2L 779115..779229 84..198 305 84.3 Plus
chr2L 23010047 chr2L 779123..779208 116..201 250 86 Plus
chr2L 23010047 chr2L 779183..779268 56..141 250 86 Plus
chr2L 23010047 chr2L 779120..779200 125..205 240 86.4 Plus
chr2L 23010047 chr2L 779192..779272 53..133 240 86.4 Plus
chr2L 23010047 chr2L 779115..779181 132..198 215 88.1 Plus
chr2L 23010047 chr2L 779199..779265 48..114 215 88.1 Plus
chr2L 23010047 chr2L 773467..773547 1..81 210 84 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 779209..779658 1..450 2250 100 Plus
2L 23513712 2L 779256..779365 96..205 385 90 Plus
2L 23513712 2L 779304..779413 48..157 385 90 Plus
2L 23513712 2L 779256..779370 84..198 305 84.3 Plus
2L 23513712 2L 779292..779406 48..162 305 84.3 Plus
2L 23513712 2L 779264..779349 116..201 250 86 Plus
2L 23513712 2L 779324..779409 56..141 250 86 Plus
2L 23513712 2L 779261..779341 125..205 240 86.4 Plus
2L 23513712 2L 779333..779413 53..133 240 86.4 Plus
2L 23513712 2L 779340..779406 48..114 215 88.1 Plus
2L 23513712 2L 779256..779322 132..198 215 88.1 Plus
2L 23513712 2L 773600..773680 1..81 210 84 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 779209..779658 1..450 2250 100 Plus
2L 23513712 2L 773600..773680 1..81 210 83.9 Plus
Blast to na_te.dros performed on 2019-03-15 15:03:43 has no hits.

IP20553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:04:46 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 779401..779523 325..447 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:46 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:19 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:00:39 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:43 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:00 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-12 10:25:51 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:18 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 9..455 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:00:39 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 37..483 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:44 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:00 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
CG13947-RA 37..483 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:46 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 779209..779655 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:46 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 779209..779655 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:46 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 779209..779655 1..447 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:00:39 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 779209..779655 1..447 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:02 Download gff for IP20553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 779209..779655 1..447 100   Plus

IP20553.hyp Sequence

Translation from 0 to 447

> IP20553.hyp
FLHHHRPLRTDCRGCRSRWTPGRTSGWTSGWTSRWTTGRTPGWTSRWTPG
WSSGRTPGWTAGRTPGWSWWTRWTRGTVGTASKCHSSQQQHYHHHHFNDH
RIQHQHNHGSQHRVIPCLRRRTPANLKSIFGLFSSALSSILIKVFSAKS
Sequence IP20553.hyp has no blast hits.

IP20553.pep Sequence

Translation from 1 to 354

> IP20553.pep
SFIIIALFALIAVAAAQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQG
GPQGGPQGGPQGGPQGGPGGPGGPGGPWGLPPNATLPSNSTTTTTTSTTT
ESSTSTTTEASTESSPA*

IP20553.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13947-PA 119 CG13947-PA 3..119 1..117 640 100 Plus
CG12506-PA 107 CG12506-PA 3..107 1..111 351 66.7 Plus
CG13946-PA 99 CG13946-PA 3..99 1..110 325 63.1 Plus
lcs-PA 145 CG12794-PA 3..135 1..115 272 54.5 Plus
CG10918-PA 183 CG10918-PA 3..162 1..115 186 38.3 Plus
Mur82C-PB 578 CG12586-PB 403..472 16..79 165 63.5 Plus
CG8157-PB 113 CG8157-PB 3..83 3..81 158 53 Plus
CG8157-PA 113 CG8157-PA 3..83 3..81 158 53 Plus
Cpr47Ef-PD 601 CG13214-PD 482..550 16..87 153 56.2 Plus
Cpr47Ef-PC 612 CG13214-PC 493..561 16..87 153 56.2 Plus
Mur82C-PB 578 CG12586-PB 411..476 18..77 149 61.4 Plus
CG5172-PD 172 CG5172-PD 60..114 22..76 149 60 Plus
Mur82C-PB 578 CG12586-PB 402..469 23..79 148 59.4 Plus
Hrb87F-PE 385 CG12749-PE 251..317 18..79 147 53.7 Plus
Hrb87F-PD 385 CG12749-PD 251..317 18..79 147 53.7 Plus
Hrb87F-PC 385 CG12749-PC 251..317 18..79 147 53.7 Plus
Hrb87F-PA 385 CG12749-PA 251..317 18..79 147 53.7 Plus
CG5172-PD 172 CG5172-PD 60..130 18..89 146 51.4 Plus
CG9757-PB 127 CG9757-PB 61..126 18..79 145 59.7 Plus
CG9757-PA 127 CG9757-PA 61..126 18..79 145 59.7 Plus
Cpr47Ef-PD 601 CG13214-PD 29..130 12..95 144 41.2 Plus
Cpr47Ef-PC 612 CG13214-PC 29..130 12..95 144 41.2 Plus
Cpr47Ef-PD 601 CG13214-PD 473..546 18..89 143 50 Plus
Cpr47Ef-PC 612 CG13214-PC 475..533 17..77 143 54.1 Plus
Cpr47Ef-PD 601 CG13214-PD 454..522 18..77 142 48.6 Plus
CG8157-PB 113 CG8157-PB 36..91 19..76 141 62.7 Plus
CG8157-PA 113 CG8157-PA 36..91 19..76 141 62.7 Plus
CG9757-PB 127 CG9757-PB 41..122 13..79 140 50 Plus
CG9757-PA 127 CG9757-PA 41..122 13..79 140 50 Plus
CG7294-PA 127 CG7294-PA 8..121 1..111 139 37.7 Plus
CG5172-PD 172 CG5172-PD 9..100 2..79 138 42.4 Plus
CG5172-PC 106 CG5172-PC 9..85 2..76 137 46.2 Plus
CG7299-PC 177 CG7299-PC 62..140 19..96 136 47.5 Plus
CG7299-PA 177 CG7299-PA 62..140 19..96 136 47.5 Plus
CG8157-PB 113 CG8157-PB 38..97 17..79 135 60.9 Plus
CG8157-PA 113 CG8157-PA 38..97 17..79 135 60.9 Plus
CG11458-PA 98 CG11458-PA 10..88 3..79 135 49.4 Plus