Clone IP20556 Report

Search the DGRC for IP20556

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:56
Vector:pOT2
Associated Gene/TranscriptCG32457-RC
Protein status:IP20556.pep: gold
Sequenced Size:571

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32457 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP20556.complete Sequence

571 bp assembled on 2008-05-14

GenBank Submission: BT032747

> IP20556.complete
CAAACACTAAGTATACACTCGTTTGTGATGCGTCGCACTTGGGTCCTGTT
TTACTTATTCCTAATTGGGTTGGCATTGGTAAAGACCACACCGAAAGAAC
TTCACTCAGAATCGATTTTTGAAGATGACGTCGCTCTAAGGTCCAAGTCA
ATCATTACAACAACCCGACCACCTGTGACAATCAGGCGCGTTGTAGCCAA
GTCAAAGGGTAAGGATCCAGAAAGAACTGACCTCCACCGCAAGCACCTCA
CACATCACAAACATCACTCAAAAAACAAAAAAAAGAATCCACATAATCGT
GCCGAAGCGAATCGAAACAAGGATCATAGTCCCCATGATCCCCACAAAAA
CCTGAAAAGAAAGGCAGAGGCACTCCCTAAGTCAAATCAGAATATAAATG
GCACTACTTCTCTGGAAGCCAAGAGTACGTCTTTAAAAGATGTACATAAG
TGAACGTCAATTTCTTTGCGTCAATACCTACTACGTATCCCTGACCATAT
AAATGTAATGATGTAATGTATTGCCAACAAATAATAAATTAAACTAACTA
AAAACAAAAAAAAAAAAAAAA

IP20556.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-RC 686 CG32457-RC 1..557 1..557 2785 100 Plus
CG32457-RB 621 CG32457-RB 218..621 152..555 2020 100 Plus
CG32457-RB 621 CG32457-RB 1..151 1..151 755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22976779..22977182 152..555 2020 100 Plus
chr3L 24539361 chr3L 22976562..22976712 1..151 755 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22987859..22988264 152..557 2030 100 Plus
3L 28110227 3L 22987642..22987792 1..151 755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22980959..22981364 152..557 2030 100 Plus
3L 28103327 3L 22980742..22980892 1..151 755 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:51:21 has no hits.

IP20556.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:14 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22976562..22976712 1..151 100 -> Plus
chr3L 22976779..22977182 152..555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:41 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..426 28..453 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:21 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..426 28..453 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:57 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG11776-RA 778..797 304..323 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:54 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..426 28..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:41 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..555 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:21 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..555 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:49:57 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:54 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32457-RC 1..555 1..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22987792 1..151 100 -> Plus
3L 22987859..22988262 152..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22987792 1..151 100 -> Plus
3L 22987859..22988262 152..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22987642..22987792 1..151 100 -> Plus
3L 22987859..22988262 152..555 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:21 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22980742..22980892 1..151 100 -> Plus
arm_3L 22980959..22981362 152..555 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:09 Download gff for IP20556.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22980742..22980892 1..151 100 -> Plus
3L 22980959..22981362 152..555 100   Plus

IP20556.pep Sequence

Translation from 0 to 452

> IP20556.pep
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
IITTTRPPVTIRRVVAKSKGKDPERTDLHRKHLTHHKHHSKNKKKNPHNR
AEANRNKDHSPHDPHKNLKRKAEALPKSNQNINGTTSLEAKSTSLKDVHK
*

IP20556.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16658-PA 188 GG16658-PA 1..170 10..148 336 49.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-PC 141 CG32457-PC 1..141 10..150 742 100 Plus
CG32457-PB 163 CG32457-PB 1..163 10..150 708 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19495-PA 139 GM19495-PA 1..139 10..126 396 66.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17954-PA 131 GD17954-PA 1..129 10..116 389 69.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18121-PA 188 GE18121-PA 1..170 10..148 329 49.4 Plus

IP20556.hyp Sequence

Translation from 0 to 452

> IP20556.hyp
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
IITTTRPPVTIRRVVAKSKGKDPERTDLHRKHLTHHKHHSKNKKKNPHNR
AEANRNKDHSPHDPHKNLKRKAEALPKSNQNINGTTSLEAKSTSLKDVHK
*

IP20556.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32457-PC 141 CG32457-PC 1..141 10..150 742 100 Plus
CG32457-PB 163 CG32457-PB 1..163 10..150 708 85.9 Plus