IP20556.complete Sequence
571 bp assembled on 2008-05-14
GenBank Submission: BT032747
> IP20556.complete
CAAACACTAAGTATACACTCGTTTGTGATGCGTCGCACTTGGGTCCTGTT
TTACTTATTCCTAATTGGGTTGGCATTGGTAAAGACCACACCGAAAGAAC
TTCACTCAGAATCGATTTTTGAAGATGACGTCGCTCTAAGGTCCAAGTCA
ATCATTACAACAACCCGACCACCTGTGACAATCAGGCGCGTTGTAGCCAA
GTCAAAGGGTAAGGATCCAGAAAGAACTGACCTCCACCGCAAGCACCTCA
CACATCACAAACATCACTCAAAAAACAAAAAAAAGAATCCACATAATCGT
GCCGAAGCGAATCGAAACAAGGATCATAGTCCCCATGATCCCCACAAAAA
CCTGAAAAGAAAGGCAGAGGCACTCCCTAAGTCAAATCAGAATATAAATG
GCACTACTTCTCTGGAAGCCAAGAGTACGTCTTTAAAAGATGTACATAAG
TGAACGTCAATTTCTTTGCGTCAATACCTACTACGTATCCCTGACCATAT
AAATGTAATGATGTAATGTATTGCCAACAAATAATAAATTAAACTAACTA
AAAACAAAAAAAAAAAAAAAA
IP20556.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:57:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32457-RC | 686 | CG32457-RC | 1..557 | 1..557 | 2785 | 100 | Plus |
CG32457-RB | 621 | CG32457-RB | 218..621 | 152..555 | 2020 | 100 | Plus |
CG32457-RB | 621 | CG32457-RB | 1..151 | 1..151 | 755 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 22976779..22977182 | 152..555 | 2020 | 100 | Plus |
chr3L | 24539361 | chr3L | 22976562..22976712 | 1..151 | 755 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22987859..22988264 | 152..557 | 2030 | 100 | Plus |
3L | 28110227 | 3L | 22987642..22987792 | 1..151 | 755 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 22980959..22981364 | 152..557 | 2030 | 100 | Plus |
3L | 28103327 | 3L | 22980742..22980892 | 1..151 | 755 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 16:51:21 has no hits.
IP20556.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:14 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 22976562..22976712 | 1..151 | 100 | -> | Plus |
chr3L | 22976779..22977182 | 152..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:41 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..426 | 28..453 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:21 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..426 | 28..453 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:57 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11776-RA | 778..797 | 304..323 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:54 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..426 | 28..453 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:41 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..555 | 1..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:21 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..555 | 1..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:49:57 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:54 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32457-RC | 1..555 | 1..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22987642..22987792 | 1..151 | 100 | -> | Plus |
3L | 22987859..22988262 | 152..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22987642..22987792 | 1..151 | 100 | -> | Plus |
3L | 22987859..22988262 | 152..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:14 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22987642..22987792 | 1..151 | 100 | -> | Plus |
3L | 22987859..22988262 | 152..555 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:21 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22980742..22980892 | 1..151 | 100 | -> | Plus |
arm_3L | 22980959..22981362 | 152..555 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:09 Download gff for
IP20556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22980742..22980892 | 1..151 | 100 | -> | Plus |
3L | 22980959..22981362 | 152..555 | 100 | | Plus |
IP20556.pep Sequence
Translation from 0 to 452
> IP20556.pep
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
IITTTRPPVTIRRVVAKSKGKDPERTDLHRKHLTHHKHHSKNKKKNPHNR
AEANRNKDHSPHDPHKNLKRKAEALPKSNQNINGTTSLEAKSTSLKDVHK
*
IP20556.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16658-PA | 188 | GG16658-PA | 1..170 | 10..148 | 336 | 49.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32457-PC | 141 | CG32457-PC | 1..141 | 10..150 | 742 | 100 | Plus |
CG32457-PB | 163 | CG32457-PB | 1..163 | 10..150 | 708 | 85.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19495-PA | 139 | GM19495-PA | 1..139 | 10..126 | 396 | 66.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17954-PA | 131 | GD17954-PA | 1..129 | 10..116 | 389 | 69.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18121-PA | 188 | GE18121-PA | 1..170 | 10..148 | 329 | 49.4 | Plus |
IP20556.hyp Sequence
Translation from 0 to 452
> IP20556.hyp
QTLSIHSFVMRRTWVLFYLFLIGLALVKTTPKELHSESIFEDDVALRSKS
IITTTRPPVTIRRVVAKSKGKDPERTDLHRKHLTHHKHHSKNKKKNPHNR
AEANRNKDHSPHDPHKNLKRKAEALPKSNQNINGTTSLEAKSTSLKDVHK
*
IP20556.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32457-PC | 141 | CG32457-PC | 1..141 | 10..150 | 742 | 100 | Plus |
CG32457-PB | 163 | CG32457-PB | 1..163 | 10..150 | 708 | 85.9 | Plus |