IP20560.complete Sequence
773 bp assembled on 2009-06-08
GenBank Submission: BT088778.1
> IP20560.complete
AAAAGAGACAAAATATACACGAAACTAAAAGCTCCCAATATCAGCACCAT
ATATATATTTTATAGTCCACGAAATCAAACAAAACATAAATATCATAAGT
CACTCTTAGTCATTCGTCATCGAGGACTACACTACTAAGGAAACTAATTA
ATACTACAAAAACAAGGATTAAACGGCATGCAAACATGGTTCTCAAAGTG
CCGACGTCCAAAGTCCTGCTAGTCCTGGCCACCTTGTTCGCCGTGGCGGC
GATGATCAGCAGCTGGATGCCCCAGGTGGCGGCCAGTCCGCTCGCACCCA
CGGAATACGAACAGAGACGCATGATGTGCTCCACCGGCCTCAGCGATGTG
ATACAGAAGATATGCGTAAGCGGAACGGTGGCCCTTGGCGATGTATTTCC
CAACAGTTTCGGGAAGCGCAGGAAGCGCGACTTGCAGAACGTAACCGATT
TGTGCTGCAAGTCGGGTGGCTGCACCTACAGGGAGCTCTTGCAGTACTGC
AAAGGATAGTGAAGGATTCACACGGTGGCCCGAGCAGCCACAAACCACTC
CGCCAATTCCGCCACTCCGCCACTCCACCACTCCACCACTCCGCCACACC
CATCCACTGCAAATCAATTTACACCACTCCCATCATTCGTAATCCCTAAG
ATATGAAGCGCAAGCAGCAGTGTCCCCTAGAGTATACTAAGTATATTTAC
TAATTTAACTATACACTAACTAAATTCTGTACAATAAAAGAAATTTGAAG
TGAGAAAAAAAAAAAAAAAAAAA
IP20560.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:31:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6.a | 1512 | Ilp6.a | 183..936 | 1..754 | 3770 | 100 | Plus |
Ilp6-RA | 1347 | Ilp6-RA | 344..1097 | 1..754 | 3770 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:10:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 2225417..2225771 | 754..400 | 1775 | 100 | Minus |
chrX | 22417052 | chrX | 2225850..2226063 | 399..186 | 1070 | 100 | Minus |
chrX | 22417052 | chrX | 2227244..2227428 | 185..1 | 925 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2331493..2331847 | 754..400 | 1775 | 100 | Minus |
X | 23542271 | X | 2331926..2332139 | 399..186 | 1070 | 100 | Minus |
X | 23542271 | X | 2333320..2333504 | 185..1 | 925 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 2339591..2339945 | 754..400 | 1775 | 100 | Minus |
X | 23527363 | X | 2340024..2340237 | 399..186 | 1070 | 100 | Minus |
X | 23527363 | X | 2341418..2341602 | 185..1 | 925 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 15:10:13 has no hits.
IP20560.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:58 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 2225417..2225573 | 598..754 | 100 | == | Minus |
chrX | 2225627..2225771 | 400..544 | 100 | <- | Minus |
chrX | 2227244..2227428 | 1..185 | 100 | | Minus |
chrX | 2225850..2226063 | 186..399 | 100 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:02 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1..324 | 186..509 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:59 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RC | 1..324 | 186..509 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:29 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RB | 1..324 | 186..509 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:54 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RB | 1..324 | 186..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 11:36:57 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 183..936 | 1..754 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:59 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1155..1908 | 1..754 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:29 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1155..1908 | 1..754 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:54 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1155..1908 | 1..754 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2333320..2333504 | 1..185 | 100 | | Minus |
X | 2331926..2332139 | 186..399 | 100 | <- | Minus |
X | 2331493..2331847 | 400..754 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2333320..2333504 | 1..185 | 100 | | Minus |
X | 2331926..2332139 | 186..399 | 100 | <- | Minus |
X | 2331493..2331847 | 400..754 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2333320..2333504 | 1..185 | 100 | | Minus |
X | 2331926..2332139 | 186..399 | 100 | <- | Minus |
X | 2331493..2331847 | 400..754 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:29 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2225526..2225880 | 400..754 | 100 | <- | Minus |
arm_X | 2225959..2226172 | 186..399 | 100 | <- | Minus |
arm_X | 2227353..2227537 | 1..185 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:23 Download gff for
IP20560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2339591..2339945 | 400..754 | 100 | <- | Minus |
X | 2340024..2340237 | 186..399 | 100 | <- | Minus |
X | 2341418..2341602 | 1..185 | 100 | | Minus |
IP20560.hyp Sequence
Translation from 185 to 508
> IP20560.hyp
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG*
IP20560.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:12:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6-PD | 107 | CG14049-PD | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PC | 107 | CG14049-PC | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PB | 107 | CG14049-PB | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PA | 107 | CG14049-PA | 1..107 | 1..107 | 554 | 100 | Plus |
IP20560.pep Sequence
Translation from 185 to 508
> IP20560.pep
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG*
IP20560.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:44:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21959-PA | 122 | GF21959-PA | 1..115 | 1..105 | 196 | 44 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:44:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12622-PA | 107 | GG12622-PA | 1..107 | 1..107 | 476 | 82.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6-PD | 107 | CG14049-PD | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PC | 107 | CG14049-PC | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PB | 107 | CG14049-PB | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PA | 107 | CG14049-PA | 1..107 | 1..107 | 554 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:44:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13378-PA | 101 | GL13378-PA | 7..94 | 26..105 | 130 | 40.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:44:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA22847-PA | 101 | GA22847-PA | 7..94 | 26..105 | 130 | 40.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:44:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18888-PA | 109 | GM18888-PA | 11..109 | 9..107 | 497 | 93.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:44:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16462-PA | 123 | GJ16462-PA | 10..120 | 1..105 | 132 | 35.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:44:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10998-PA | 111 | GE10998-PA | 1..107 | 1..107 | 445 | 76.6 | Plus |