Clone IP20560 Report

Search the DGRC for IP20560

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:60
Vector:pOT2
Associated Gene/TranscriptIlp6-RA
Protein status:IP20560.pep: gold
Sequenced Size:773

Clone Sequence Records

IP20560.complete Sequence

773 bp assembled on 2009-06-08

GenBank Submission: BT088778.1

> IP20560.complete
AAAAGAGACAAAATATACACGAAACTAAAAGCTCCCAATATCAGCACCAT
ATATATATTTTATAGTCCACGAAATCAAACAAAACATAAATATCATAAGT
CACTCTTAGTCATTCGTCATCGAGGACTACACTACTAAGGAAACTAATTA
ATACTACAAAAACAAGGATTAAACGGCATGCAAACATGGTTCTCAAAGTG
CCGACGTCCAAAGTCCTGCTAGTCCTGGCCACCTTGTTCGCCGTGGCGGC
GATGATCAGCAGCTGGATGCCCCAGGTGGCGGCCAGTCCGCTCGCACCCA
CGGAATACGAACAGAGACGCATGATGTGCTCCACCGGCCTCAGCGATGTG
ATACAGAAGATATGCGTAAGCGGAACGGTGGCCCTTGGCGATGTATTTCC
CAACAGTTTCGGGAAGCGCAGGAAGCGCGACTTGCAGAACGTAACCGATT
TGTGCTGCAAGTCGGGTGGCTGCACCTACAGGGAGCTCTTGCAGTACTGC
AAAGGATAGTGAAGGATTCACACGGTGGCCCGAGCAGCCACAAACCACTC
CGCCAATTCCGCCACTCCGCCACTCCACCACTCCACCACTCCGCCACACC
CATCCACTGCAAATCAATTTACACCACTCCCATCATTCGTAATCCCTAAG
ATATGAAGCGCAAGCAGCAGTGTCCCCTAGAGTATACTAAGTATATTTAC
TAATTTAACTATACACTAACTAAATTCTGTACAATAAAAGAAATTTGAAG
TGAGAAAAAAAAAAAAAAAAAAA

IP20560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6.a 1512 Ilp6.a 183..936 1..754 3770 100 Plus
Ilp6-RA 1347 Ilp6-RA 344..1097 1..754 3770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2225417..2225771 754..400 1775 100 Minus
chrX 22417052 chrX 2225850..2226063 399..186 1070 100 Minus
chrX 22417052 chrX 2227244..2227428 185..1 925 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2331493..2331847 754..400 1775 100 Minus
X 23542271 X 2331926..2332139 399..186 1070 100 Minus
X 23542271 X 2333320..2333504 185..1 925 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2339591..2339945 754..400 1775 100 Minus
X 23527363 X 2340024..2340237 399..186 1070 100 Minus
X 23527363 X 2341418..2341602 185..1 925 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:10:13 has no hits.

IP20560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:58 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2225417..2225573 598..754 100 == Minus
chrX 2225627..2225771 400..544 100 <- Minus
chrX 2227244..2227428 1..185 100   Minus
chrX 2225850..2226063 186..399 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:02 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1..324 186..509 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:59 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RC 1..324 186..509 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:29 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RB 1..324 186..509 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:54 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RB 1..324 186..509 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 11:36:57 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 183..936 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:59 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1155..1908 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:29 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1155..1908 1..754 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:54 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1155..1908 1..754 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
X 2333320..2333504 1..185 100   Minus
X 2331926..2332139 186..399 100 <- Minus
X 2331493..2331847 400..754 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
X 2333320..2333504 1..185 100   Minus
X 2331926..2332139 186..399 100 <- Minus
X 2331493..2331847 400..754 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:58 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
X 2333320..2333504 1..185 100   Minus
X 2331926..2332139 186..399 100 <- Minus
X 2331493..2331847 400..754 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:29 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2225526..2225880 400..754 100 <- Minus
arm_X 2225959..2226172 186..399 100 <- Minus
arm_X 2227353..2227537 1..185 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:23 Download gff for IP20560.complete
Subject Subject Range Query Range Percent Splice Strand
X 2339591..2339945 400..754 100 <- Minus
X 2340024..2340237 186..399 100 <- Minus
X 2341418..2341602 1..185 100   Minus

IP20560.hyp Sequence

Translation from 185 to 508

> IP20560.hyp
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG*

IP20560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6-PD 107 CG14049-PD 1..107 1..107 554 100 Plus
Ilp6-PC 107 CG14049-PC 1..107 1..107 554 100 Plus
Ilp6-PB 107 CG14049-PB 1..107 1..107 554 100 Plus
Ilp6-PA 107 CG14049-PA 1..107 1..107 554 100 Plus

IP20560.pep Sequence

Translation from 185 to 508

> IP20560.pep
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG*

IP20560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21959-PA 122 GF21959-PA 1..115 1..105 196 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12622-PA 107 GG12622-PA 1..107 1..107 476 82.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6-PD 107 CG14049-PD 1..107 1..107 554 100 Plus
Ilp6-PC 107 CG14049-PC 1..107 1..107 554 100 Plus
Ilp6-PB 107 CG14049-PB 1..107 1..107 554 100 Plus
Ilp6-PA 107 CG14049-PA 1..107 1..107 554 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13378-PA 101 GL13378-PA 7..94 26..105 130 40.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22847-PA 101 GA22847-PA 7..94 26..105 130 40.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18888-PA 109 GM18888-PA 11..109 9..107 497 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16462-PA 123 GJ16462-PA 10..120 1..105 132 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10998-PA 111 GE10998-PA 1..107 1..107 445 76.6 Plus