Clone IP20580 Report

Search the DGRC for IP20580

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:205
Well:80
Vector:pOT2
Associated Gene/TranscriptTim13-RA
Protein status:IP20580.pep: gold
Sequenced Size:460

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tim13 2008-05-05 Release 5.5 slip selected
Tim13 2008-08-15 Release 5.9 accounting
Tim13 2008-12-18 5.12 accounting

Clone Sequence Records

IP20580.complete Sequence

460 bp assembled on 2008-05-14

GenBank Submission: BT032752

> IP20580.complete
CAGCTGTGTTCCTTCTGTCTGAGTTTTGCTTAAAGCGTTCAAATTTTGTG
ATATTATAAATTTAAATTGTTTAACGAGCAAACACCGAAATGGCGGCTGC
CAACATGGAGAAGGGTGAGCTGATGAACCAGGTGAAACAACAGATCGCAT
TGGCCAATGCCCAGGAGATGCTCTCGAAGATGACGGAGAAGTGCTTCAAG
AAGTGCATCCAGAAGCCGGGAAAATCACTGGACTCCACCGAGCAGCGTTG
CATTTCGCAGTGCATGGATCGCTTCATGGACGCCTGGAATCTGGTGTCGC
GCACCTATGGCAATCGTCTGCAGCGTGAACAGTACAGGACCATGGAATCG
TTGGAGATGACCAGCTAGGACTAGCAGCTAGGATTAGCAGCTAGATTGCA
CTCATCTTGCAATTAAAATCGAATTTATTTTGTTTGTGATCCAAAAAAAA
AAAAAAAAAA

IP20580.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-RA 442 Tim13-RA 1..442 1..442 2210 100 Plus
CG34132-RA 674 CG34132-RA 178..361 106..289 260 76 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11764959..11765400 442..1 2195 99.8 Minus
chr2L 23010047 chr2L 7884702..7884818 106..222 210 78.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11774058..11774501 444..1 2220 100 Minus
2L 23513712 2L 7885665..7885781 106..222 210 78.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11767158..11767601 444..1 2220 100 Minus
2L 23513712 2L 7885665..7885781 106..222 210 78.6 Plus
Blast to na_te.dros performed on 2019-03-16 09:26:44 has no hits.

IP20580.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:27:22 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11764959..11765400 1..442 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:21:57 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:49:53 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:29 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:12 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:29 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:48 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:49:53 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..442 1..442 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:29 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..442 1..442 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:12 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..279 90..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:29 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..442 1..442 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:27:22 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11774060..11774501 1..442 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:27:22 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11774060..11774501 1..442 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:27:22 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11774060..11774501 1..442 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:29 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11767160..11767601 1..442 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:41 Download gff for IP20580.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11767160..11767601 1..442 100   Minus

IP20580.pep Sequence

Translation from 89 to 367

> IP20580.pep
MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDST
EQRCISQCMDRFMDAWNLVSRTYGNRLQREQYRTMESLEMTS*

IP20580.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24514-PA 92 GF24514-PA 1..92 1..92 448 89.1 Plus
Dana\GF21863-PA 84 GF21863-PA 1..83 1..83 350 73.5 Plus
Dana\GF21719-PA 85 GF21719-PA 14..80 14..80 205 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13890-PA 93 GG13890-PA 1..89 1..89 447 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16382-PA 92 GH16382-PA 1..88 1..88 333 64.8 Plus
Dgri\GH10210-PA 82 GH10210-PA 2..81 4..83 319 68.8 Plus
Dgri\GH11842-PA 85 GH11842-PA 6..80 7..81 223 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-PA 92 CG11611-PA 1..92 1..92 475 100 Plus
CG34132-PA 84 CG34132-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 185 48.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11575-PA 91 GI11575-PA 1..81 1..81 352 76.5 Plus
Dmoj\GI14974-PA 84 GI14974-PA 1..81 1..81 341 71.6 Plus
Dmoj\GI14992-PA 83 GI14992-PA 10..81 9..80 232 58.3 Plus
Dmoj\GI14322-PA 87 GI14322-PA 4..84 3..83 228 50.6 Plus
Dmoj\GI14321-PA 105 GI14321-PA 15..91 4..80 202 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20826-PA 92 GL20826-PA 5..85 3..83 369 81.5 Plus
Dper\GL18649-PA 56 GL18649-PA 1..56 1..56 209 69.6 Plus
Dper\GL16403-PA 666 GL16403-PA 572..652 10..86 138 35.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11098-PA 92 GA11098-PA 5..85 3..83 372 82.7 Plus
Dpse\GA25739-PA 94 GA25739-PA 1..91 1..81 327 67 Plus
Dpse\GA27814-PA 470 GA27814-PA 376..456 10..86 153 38.3 Plus
Dpse\GA24508-PA 111 GA24508-PA 19..87 12..80 150 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24714-PA 93 GM24714-PA 1..89 1..89 461 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12777-PA 93 GD12777-PA 1..93 1..92 462 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11254-PA 92 GJ11254-PA 1..87 1..87 359 74.7 Plus
Dvir\GJ17233-PA 83 GJ17233-PA 2..82 3..83 338 71.6 Plus
Dvir\GJ19379-PA 87 GJ19379-PA 4..84 3..83 247 54.3 Plus
Dvir\GJ15348-PA 68 GJ15348-PA 1..67 15..81 229 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11560-PA 120 GK11560-PA 1..79 1..79 340 74.7 Plus
Dwil\GK12379-PA 720 GK12379-PA 2..77 4..79 287 69.7 Plus
Dwil\GK10163-PA 87 GK10163-PA 10..87 10..86 266 61.5 Plus
Dwil\GK21816-PA 88 GK21816-PA 20..88 15..85 142 38 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20181-PA 93 GE20181-PA 1..89 1..89 453 94.4 Plus
Dyak\GE15496-PA 125 GE15496-PA 8..69 12..73 182 51.6 Plus

IP20580.hyp Sequence

Translation from 89 to 367

> IP20580.hyp
MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDST
EQRCISQCMDRFMDAWNLVSRTYGNRLQREQYRTMESLEMTS*

IP20580.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-PA 92 CG11611-PA 1..92 1..92 475 100 Plus
CG34132-PA 84 CG34132-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 185 48.6 Plus