Clone IP20607 Report

Search the DGRC for IP20607

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:206
Well:7
Vector:pOT2
Associated Gene/TranscriptCG34034-RB
Protein status:IP20607.pep: gold
Sequenced Size:659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34034 2008-05-05 Release 5.5 slip selected
CG34034 2008-08-15 Release 5.9 accounting
CG34034 2008-12-18 5.12 accounting

Clone Sequence Records

IP20607.complete Sequence

659 bp assembled on 2008-05-27

GenBank Submission: BT032950

> IP20607.complete
CCAGCGAGAAGATGTCGTCGATTTCTACGATCATTGGATTGTGTCTTTTG
TTCTTTATGCTGAGCAATGTGGATGCTTATGGGCAAAAATGTAGTCCAGT
CTTTGGAAATTGCAACATGCATACAGATTGCTGCAGCGGAAAATGCTTAA
CCTACGGCTCACGTTGTGGCTATCCTGCGCACCGTCTTAAAGAAACATAT
TTGAGTGCCAGTGAATTTCAGAGTATCAAAAAACAACGGGCACATTCAAA
CAATGATGAGGTGAAAGTTATTGGTCTACCTAGTGAGTCAGAACCATCGA
ATGTTTTTTTTAAGATTGATTCGGCAGCAAAATGCCACAATGTTGGTGAA
CCCTGCTCCCGGGGTGAAGAATGCTGTAATTTGAGATGTCACTCATATAT
GCACAGATGTGTCACCTAAAGTAATTCATAGCAATGAGGAAACGTGACAG
ACAGCTAATTACCAAAATAATTCAGATTCACTTAGGGCGCGGCCCTTAAT
ATATTCATTGGAAATAATGTTACAACAGCTCTACATTCTGTTCCGTAATT
AATGGTTATAGAAATAAAGGTTTATCCATGCTGAAAACTTGTATATAGTT
TTGTCACAATATCACAATAAATAAATAAACCATACATAAAAAAAAAAAAA
AAAAAAAAA

IP20607.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34034-RB 769 CG34034-RB 132..769 1..638 3190 100 Plus
CG34034-RA 563 CG34034-RA 1..353 1..353 1765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17562101..17562384 637..354 1315 97.5 Minus
chr3R 27901430 chr3R 17562453..17562694 352..111 1195 99.6 Minus
chr3R 27901430 chr3R 17562757..17562866 110..1 535 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21738344..21738628 638..354 1425 100 Minus
3R 32079331 3R 21738696..21738938 353..111 1215 100 Minus
3R 32079331 3R 21739001..21739110 110..1 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21479175..21479459 638..354 1425 100 Minus
3R 31820162 3R 21479527..21479769 353..111 1215 100 Minus
3R 31820162 3R 21479832..21479941 110..1 550 100 Minus
Blast to na_te.dros performed 2019-03-16 13:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 82..136 636..582 122 69.1 Minus

IP20607.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:20:59 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17562101..17562384 354..637 97 <- Minus
chr3R 17562452..17562694 111..353 99 <- Minus
chr3R 17562757..17562866 1..110 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:07 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..408 12..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:06 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..408 12..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:16 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..408 12..419 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:18 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RA 1..347 12..362 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:32 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..408 12..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:53 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:06 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:16 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:46:18 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RA 1..347 12..362 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:32 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
CG34034-RB 1..637 1..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:59 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21738345..21738628 354..637 100 <- Minus
3R 21738696..21738938 111..353 100 <- Minus
3R 21739001..21739110 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:59 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21738345..21738628 354..637 100 <- Minus
3R 21738696..21738938 111..353 100 <- Minus
3R 21739001..21739110 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:59 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21738345..21738628 354..637 100 <- Minus
3R 21738696..21738938 111..353 100 <- Minus
3R 21739001..21739110 1..110 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:16 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17564723..17564832 1..110 100   Minus
arm_3R 17564067..17564350 354..637 100 <- Minus
arm_3R 17564418..17564660 111..353 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:09 Download gff for IP20607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21479176..21479459 354..637 100 <- Minus
3R 21479527..21479769 111..353 100 <- Minus
3R 21479832..21479941 1..110 100   Minus

IP20607.hyp Sequence

Translation from 2 to 418

> IP20607.hyp
SEKMSSISTIIGLCLLFFMLSNVDAYGQKCSPVFGNCNMHTDCCSGKCLT
YGSRCGYPAHRLKETYLSASEFQSIKKQRAHSNNDEVKVIGLPSESEPSN
VFFKIDSAAKCHNVGEPCSRGEECCNLRCHSYMHRCVT*

IP20607.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34034-PB 135 CG34034-PB 1..135 4..138 747 100 Plus

IP20607.pep Sequence

Translation from 2 to 418

> IP20607.pep
SEKMSSISTIIGLCLLFFMLSNVDAYGQKCSPVFGNCNMHTDCCSGKCLT
YGSRCGYPAHRLKETYLSASEFQSIKKQRAHSNNDEVKVIGLPSESEPSN
VFFKIDSAAKCHNVGEPCSRGEECCNLRCHSYMHRCVT*

IP20607.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22913-PA 202 GG22913-PA 1..122 4..121 443 71.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34034-PB 135 CG34034-PB 1..135 4..138 747 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23698-PA 198 GM23698-PA 1..114 4..117 511 85.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18507-PA 198 GD18507-PA 1..114 4..117 542 88.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24091-PA 175 GE24091-PA 1..84 4..86 296 66.7 Plus
Dyak\GE25843-PA 132 GE25843-PA 1..59 39..97 194 59.3 Plus