Clone IP20609 Report

Search the DGRC for IP20609

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:206
Well:9
Vector:pOT2
Associated Gene/Transcriptlectin-30A-RA
Protein status:IP20609.pep: gold
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
lectin-30A 2008-05-05 Release 5.5 slip selected
lectin-30A 2008-08-15 Release 5.9 accounting
lectin-30A 2008-12-18 5.12 accounting

Clone Sequence Records

IP20609.complete Sequence

800 bp assembled on 2008-05-14

GenBank Submission: BT032756

> IP20609.complete
ACTAGCAGGTCATACATAGTAACATGTTCAAGTATTGTTTTATATGCGTC
ATTCTAGCCTGGGCTTCTCGTGATGTTCTCGCTAACAAAACGGAAAATCC
GCTGCTAATTGATCAAGTGGCTATAAATCAACAACAATGGTTCACATTCA
TTGCGCTGAAGGAAAGTGAAATGCAACAGAAAATAGTGAGGATCGAAAGA
TCGATAGAAGAACGATTGATGGCCATGCAAAGCAAGTTGGCATACGCACT
GAACGAGCTGCAGACCATAATGGGCAACCAGAGTGTGGAGACTCTCGAGA
AACTACGAATCTCGCACAGGATTAATCCGGCGCTTTTCCAGAGAATGGGC
ACAAGACGCTTCTACATTGAGAAGGAAAACAAACAAAATTGGTTTGGCGC
CTCAAACACCTGTCGTCAATTGGGCGGTCACATTGCCACCATCAGGGATG
AGCAGGAGTTTAATGAGATCTTCTCAAGAGCGCCGGCCGGCGTCTTTTGG
ATAGATATGAATGCTATGTTCAAGAACGGCCTTTTTGCATCATCACTCAC
CGGCAGATCGCCGCCGTTCTTTAAGTGGAAGAAAGAAGAAAGGGGCAATA
AGTTCGATTGCGTTAATGTATACAACAAGGAAATGTACAATGAAAATTGT
TTCAACACCCATTTGTTCATATGTCAAGCCGAGCAGTGGGATTGATGCGA
ATGCGAAAATAATAAATTAAGTTATTTTCATTTTGCATCTCGGCAATTTA
CCGACAGCTTTTAATAAAGTTATGAGCCTAAAAAAAAAAAAAAAAAAAAA

IP20609.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-30A-RA 779 lectin-30A-RA 1..779 1..779 3895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9253017..9253795 779..1 3880 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9254075..9254854 780..1 3900 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9254075..9254854 780..1 3900 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:20:02 has no hits.

IP20609.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:20:47 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9253017..9253795 1..779 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:10 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:30 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:49:21 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:29 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:57:10 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:36 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:30 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..779 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:49:21 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..779 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:30 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..672 24..695 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:57:10 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-30A-RA 1..779 1..779 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:47 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9254076..9254854 1..779 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:47 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9254076..9254854 1..779 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:47 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9254076..9254854 1..779 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:49:21 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9254076..9254854 1..779 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:50 Download gff for IP20609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9254076..9254854 1..779 100   Minus

IP20609.hyp Sequence

Translation from 23 to 694

> IP20609.hyp
MFKYCFICVILAWASRDVLANKTENPLLIDQVAINQQQWFTFIALKESEM
QQKIVRIERSIEERLMAMQSKLAYALNELQTIMGNQSVETLEKLRISHRI
NPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIF
SRAPAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEERGNKFDCVNVY
NKEMYNENCFNTHLFICQAEQWD*

IP20609.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-30A-PA 223 CG17011-PA 1..223 1..223 1186 100 Plus
lectin-29Ca-PA 236 CG17799-PA 1..235 1..222 396 35.4 Plus
Acp29AB-PA 234 CG17797-PA 42..233 29..222 386 39.8 Plus
lectin-21Cb-PB 249 CG13686-PB 85..248 51..219 247 31.6 Plus
lectin-22C-PB 263 CG42295-PB 84..260 50..223 242 32.4 Plus

IP20609.pep Sequence

Translation from 23 to 694

> IP20609.pep
MFKYCFICVILAWASRDVLANKTENPLLIDQVAINQQQWFTFIALKESEM
QQKIVRIERSIEERLMAMQSKLAYALNELQTIMGNQSVETLEKLRISHRI
NPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIF
SRAPAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEERGNKFDCVNVY
NKEMYNENCFNTHLFICQAEQWD*

IP20609.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15345-PA 204 GF15345-PA 7..200 6..220 235 28.1 Plus
Dana\GF15691-PA 176 GF15691-PA 36..172 88..219 231 32.1 Plus
Dana\GF19731-PA 235 GF19731-PA 28..232 13..218 227 30 Plus
Dana\GF15692-PA 176 GF15692-PA 25..172 77..219 210 30.4 Plus
Dana\GF19803-PA 189 GF19803-PA 56..185 95..219 204 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24034-PA 276 GG24034-PA 52..271 12..222 683 56.8 Plus
Dere\GG23444-PA 165 GG23444-PA 5..164 61..222 348 40.2 Plus
Dere\GG21745-PA 255 GG21745-PA 48..250 28..220 263 29 Plus
Dere\GG24734-PA 269 GG24734-PA 51..265 35..218 260 29.3 Plus
Dere\GG24634-PA 172 GG24634-PA 16..171 66..219 249 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11271-PA 376 GH11271-PA 155..330 22..185 211 27.5 Plus
Dgri\GH23701-PA 385 GH23701-PA 160..339 3..185 207 27.7 Plus
Dgri\GH10464-PA 197 GH10464-PA 30..194 61..219 198 27.8 Plus
Dgri\GH24460-PA 195 GH24460-PA 46..184 96..221 167 31.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-30A-PA 223 CG17011-PA 1..223 1..223 1186 100 Plus
lectin-29Ca-PA 236 CG17799-PA 1..235 1..222 396 35.4 Plus
Acp29AB-PA 234 CG17797-PA 42..233 29..222 386 39.8 Plus
lectin-21Cb-PB 249 CG13686-PB 85..248 51..219 247 31.6 Plus
CG2839-PA 826 CG2839-PA 112..266 61..221 245 32.1 Plus
lectin-22C-PB 263 CG42295-PB 84..260 50..223 242 32.4 Plus
lectin-21Ca-PA 269 CG2826-PA 59..265 30..218 239 30.4 Plus
CG15358-PE 252 CG15358-PE 48..247 28..220 217 27.4 Plus
CG15358-PD 252 CG15358-PD 48..247 28..220 217 27.4 Plus
lectin-28C-PC 265 CG7106-PC 52..263 28..221 215 28.4 Plus
lectin-28C-PB 265 CG7106-PB 52..263 28..221 215 28.4 Plus
CG15818-PA 283 CG15818-PA 78..280 21..220 212 28.1 Plus
lectin-24Db-PA 359 CG2958-PA 164..357 28..221 208 25.4 Plus
lectin-24A-PA 282 CG3410-PA 162..279 105..218 193 34.7 Plus
CG7763-PD 232 CG7763-PD 108..227 104..218 188 33.1 Plus
CG7763-PC 232 CG7763-PC 108..227 104..218 188 33.1 Plus
CG12111-PB 188 CG12111-PB 39..177 96..221 168 30.2 Plus
CG12111-PA 188 CG12111-PA 39..177 96..221 168 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17697-PA 153 GI17697-PA 8..151 77..220 183 26.5 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..143 107..219 171 30.8 Plus
Dmoj\GI14022-PA 161 GI14022-PA 37..155 108..218 171 31.1 Plus
Dmoj\GI24639-PA 192 GI24639-PA 75..189 107..220 169 27.8 Plus
Dmoj\GI14792-PA 194 GI14792-PA 13..183 64..221 167 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26175-PA 238 GL26175-PA 23..226 37..223 222 31.2 Plus
Dper\GL26705-PA 277 GL26705-PA 105..276 62..218 220 27.7 Plus
Dper\GL10741-PA 236 GL10741-PA 51..232 28..219 209 28.1 Plus
Dper\GL23662-PA 399 GL23662-PA 279..398 105..218 172 28.9 Plus
Dper\GL26845-PA 183 GL26845-PA 54..177 105..219 168 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29024-PA 277 GA29024-PA 105..276 62..218 225 28.3 Plus
Dpse\GA25561-PA 181 GA25561-PA 27..169 92..223 208 33.3 Plus
Dpse\GA24466-PA 236 GA24466-PA 51..232 28..219 204 27.6 Plus
Dpse\GA26690-PA 396 GA26690-PA 279..395 105..218 198 32.8 Plus
Dpse\GA22633-PA 411 GA22633-PA 102..239 28..184 188 31 Plus
Dpse\GA22633-PA 411 GA22633-PA 293..395 105..203 157 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12506-PA 311 GM12506-PA 90..311 2..223 1050 86.5 Plus
Dsec\Acp29AB-PA 234 GM12975-PA 42..233 29..222 383 38.3 Plus
Dsec\GM12967-PA 235 GM12967-PA 1..234 1..222 356 34.3 Plus
Dsec\GM16651-PA 249 GM16651-PA 85..248 51..219 254 31 Plus
Dsec\GM16582-PA 268 GM16582-PA 64..263 28..220 235 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\lectin-30A-PA 223 GD22361-PA 1..223 1..223 1078 88.3 Plus
Dsim\Acp29AB-PA 234 GD22408-PA 42..233 29..222 387 37.8 Plus
Dsim\lectin-29Ca-PA 235 GD22407-PA 1..234 1..222 355 34.2 Plus
Dsim\GD22877-PA 230 GD22877-PA 33..230 19..221 255 32.4 Plus
Dsim\GD23039-PA 269 GD23039-PA 59..265 30..218 247 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16497-PA 252 GJ16497-PA 56..248 40..219 254 30 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 66..186 105..219 208 34.7 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 45..224 63..218 196 28.8 Plus
Dvir\GJ16416-PA 164 GJ16416-PA 1..161 68..219 195 30.2 Plus
Dvir\GJ19459-PA 194 GJ19459-PA 13..183 64..221 170 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 42..209 28..199 231 29 Plus
Dwil\GK18670-PA 255 GK18670-PA 134..229 105..199 177 32 Plus
Dwil\GK19037-PA 249 GK19037-PA 66..240 47..219 176 28.2 Plus
Dwil\GK19210-PA 164 GK19210-PA 41..163 105..220 160 27.6 Plus
Dwil\GK25689-PA 196 GK25689-PA 47..185 96..221 159 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10566-PA 234 GE10566-PA 1..233 1..222 641 53.8 Plus
Dyak\GE11017-PA 232 GE11017-PA 1..231 1..222 412 37.9 Plus
Dyak\GE16979-PA 269 GE16979-PA 62..265 31..218 266 34.3 Plus
Dyak\GE15323-PA 368 GE15323-PA 164..363 28..220 246 28.7 Plus
Dyak\GE15974-PA 249 GE15974-PA 95..248 68..219 239 34.6 Plus