Clone IP20615 Report

Search the DGRC for IP20615

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:206
Well:15
Vector:pOT2
Associated Gene/TranscriptCG34026-RA
Protein status:IP20615.pep: gold
Sequenced Size:443

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34026 2008-05-05 Release 5.5 slip selected
CG34026 2008-08-15 Release 5.9 accounting
CG34026 2008-12-18 5.12 accounting

Clone Sequence Records

IP20615.complete Sequence

443 bp assembled on 2008-05-22

GenBank Submission: BT032757

> IP20615.complete
TCATAGCGAAATAGTTATCAAATACAATGAAATATCCCACAATTATTTTA
TTTGCGCTAGCCGCATTCATTTTGCCAACATTTGCCGCAAATGACTACCT
GTGGGGTGAAGTTGGTGCAGATGATTACCAATTGGCAAAGGATACGGTTT
CGAAGGCGTTTTTCGTTGGTCTAGTGCAGACGAAAAAATACGTATTCAAG
CAGTCGGACAACCTAAATGCGTTGACCATTACGGCAATTAAGATTACCGA
CAAAAAGAAGAGTCACGGAGCAACTGCTGTATTGGTCAGTGGAGGTCCTG
GATCCAAAGGAGCAACTATTAAGTTCACTTCCGAACGAGGTTACGGCATC
AAGGATATCGTGGAAATATGGGGTCGTTAAATACACATAAAAATGTGGCA
TTCTACATAAATAACGCAACGCAACCGAAAAAAAAAAAAAAAA

IP20615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-RA 812 CG34026-RA 35..463 1..429 2145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9425816..9426037 206..427 1110 100 Plus
chrX 22417052 chrX 9425550..9425756 1..207 1035 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9534084..9534307 206..429 1120 100 Plus
X 23542271 X 9533818..9534024 1..207 1035 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9542182..9542405 206..429 1120 100 Plus
X 23527363 X 9541916..9542122 1..207 1035 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:08:46 has no hits.

IP20615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:09:50 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9425817..9426037 207..427 100   Plus
chrX 9425550..9425755 1..206 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:12 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:49 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:16:09 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:40 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:56 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:08 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:49 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..427 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:16:09 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..427 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:41 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..354 27..380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:56 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..427 1..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:50 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
X 9533818..9534023 1..206 100 -> Plus
X 9534085..9534305 207..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:50 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
X 9533818..9534023 1..206 100 -> Plus
X 9534085..9534305 207..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:50 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
X 9533818..9534023 1..206 100 -> Plus
X 9534085..9534305 207..427 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:16:09 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9427851..9428056 1..206 100 -> Plus
arm_X 9428118..9428338 207..427 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:19 Download gff for IP20615.complete
Subject Subject Range Query Range Percent Splice Strand
X 9542183..9542403 207..427 100   Plus
X 9541916..9542121 1..206 100 -> Plus

IP20615.hyp Sequence

Translation from 26 to 379

> IP20615.hyp
MKYPTIILFALAAFILPTFAANDYLWGEVGADDYQLAKDTVSKAFFVGLV
QTKKYVFKQSDNLNALTITAIKITDKKKSHGATAVLVSGGPGSKGATIKF
TSERGYGIKDIVEIWGR*

IP20615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-PB 117 CG34026-PB 1..117 1..117 598 100 Plus
CG34026-PA 117 CG34026-PA 1..117 1..117 598 100 Plus
CG30413-PA 122 CG30413-PA 28..120 22..116 192 48.4 Plus

IP20615.pep Sequence

Translation from 26 to 379

> IP20615.pep
MKYPTIILFALAAFILPTFAANDYLWGEVGADDYQLAKDTVSKAFFVGLV
QTKKYVFKQSDNLNALTITAIKITDKKKSHGATAVLVSGGPGSKGATIKF
TSERGYGIKDIVEIWGR*

IP20615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20010-PA 117 GF20010-PA 1..117 1..117 456 74.4 Plus
Dana\GF19738-PA 74 GF19738-PA 1..72 1..73 227 63 Plus
Dana\GF20011-PA 122 GF20011-PA 28..120 22..116 195 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18315-PA 85 GG18315-PA 25..85 57..117 280 88.5 Plus
Dere\GG20045-PA 121 GG20045-PA 16..120 13..116 155 44.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21960-PA 122 GH21960-PA 13..122 8..117 455 78.2 Plus
Dgri\GH21597-PA 116 GH21597-PA 3..116 1..117 138 32.2 Plus
Dgri\GH20161-PA 122 GH20161-PA 16..121 9..116 137 34.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-PB 117 CG34026-PB 1..117 1..117 598 100 Plus
CG34026-PA 117 CG34026-PA 1..117 1..117 598 100 Plus
CG30413-PA 122 CG30413-PA 28..120 22..116 192 48.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19667-PA 120 GI19667-PA 7..120 5..117 474 81.6 Plus
Dmoj\GI20673-PA 123 GI20673-PA 1..122 1..116 152 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16227-PA 123 GL16227-PA 1..123 1..117 446 70.7 Plus
Dper\GL16228-PA 122 GL16228-PA 1..121 1..116 156 37.4 Plus
Dper\GL10767-PA 120 GL10767-PA 29..119 26..116 131 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11373-PA 117 GM11373-PA 1..117 1..117 572 94 Plus
Dsec\GM15559-PA 121 GM15559-PA 16..120 13..116 160 45.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24776-PA 117 GD24776-PA 1..117 1..117 578 95.7 Plus
Dsim\GD25061-PA 121 GD25061-PA 16..120 13..116 159 45.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15031-PA 118 GJ15031-PA 1..118 1..117 460 72.9 Plus
Dvir\GJ20423-PA 122 GJ20423-PA 8..121 6..116 165 37.1 Plus
Dvir\GJ21142-PA 116 GJ21142-PA 5..116 3..117 157 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21373-PA 124 GK21373-PA 11..124 5..117 434 73.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17797-PA 117 GE17797-PA 1..117 1..117 580 94.9 Plus
Dyak\GE11581-PA 121 GE11581-PA 16..120 13..116 154 44.9 Plus