Clone IP20690 Report

Search the DGRC for IP20690

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:206
Well:90
Vector:pOT2
Protein status:IP20690.pep: Imported from assembly
Sequenced Size:528

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30356 2008-05-05 Release 5.5 slip selected
CG30356 2008-08-15 Release 5.9 accounting
CG30356 2008-12-18 5.12 accounting

Clone Sequence Records

IP20690.complete Sequence

528 bp assembled on 2008-05-22

GenBank Submission: BT032761

> IP20690.complete
GGACGTGCTGTAAAAAATAATAGAGTAAGGTCGGCCCATTGCAACAGTGC
CGCCAAGGCGACGTCAATCAGTGGACATTCGATGCTAAAGCAAAACAACG
ATTGCAATGGACGCAACCCGTTCTTTCAGTTTCTGGCCTACTTTCGAAAA
TGTTCCAACAACTGCCTTGGCCACTTGCCGTCGGATCGGGTAACTCTAAT
TGCCGGCAAGGTGTGGAATTACATGAGTCTGTCGGAGAAAGAACCCTTTA
TCGCTGCTGCGCGAAGATTTAACTACACGTATCGATCGCGGAGCAGAAAA
GTCAACTGGGTCCTGGCGCAACTGCGAAAATCCGCTGCTGGGGAAGAATG
CCGACCACAGGCACAGTGGATGTTGATGAACTTTTTAAAGTCTTGGCAGG
AATCTGTGGTGAGGAACCTTCTCGACCTGGATCACAATCAAAACTAAATC
AGAGCAGATTTTTATTAAGTGTAATCTTTAATAAATGATCACTCAAGGTA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP20690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30356-RA 543 CG30356-RA 41..541 1..501 2505 100 Plus
gcl-RA 2638 gcl-RA 2510..2638 501..373 645 100 Minus
gcl.c 2331 gcl.c 2289..2331 501..459 215 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4616543..4617041 499..1 2495 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8728962..8729462 501..1 2505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8730161..8730661 501..1 2505 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:08:42 has no hits.

IP20690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:29 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4616543..4617041 1..499 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:25 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 4..450 1..447 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:47 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 4..450 1..447 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:03:25 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 4..450 1..447 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:38 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 4..450 1..447 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:41 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 4..450 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:06 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 41..539 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:47 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 41..539 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:03:25 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 40..538 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:38 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 41..539 1..499 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:41 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30356-RA 40..538 1..499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:29 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8728964..8729462 1..499 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:29 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8728964..8729462 1..499 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:29 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8728964..8729462 1..499 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:03:25 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4616469..4616967 1..499 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:17 Download gff for IP20690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8730163..8730661 1..499 100   Minus

IP20690.pep Sequence

Translation from 0 to 446

> IP20690.pep
GRAVKNNRVRSAHCNSAAKATSISGHSMLKQNNDCNGRNPFFQFLAYFRK
CSNNCLGHLPSDRVTLIAGKVWNYMSLSEKEPFIAAARRFNYTYRSRSRK
VNWVLAQLRKSAAGEECRPQAQWMLMNFLKSWQESVVRNLLDLDHNQN*

IP20690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19805-PA 147 GF19805-PA 2..145 1..144 270 36.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10619-PA 150 GG10619-PA 15..150 11..148 539 74.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30356-PA 149 CG30356-PA 2..149 1..148 793 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18801-PA 140 GI18801-PA 11..136 19..144 160 31.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17360-PA 116 GL17360-PA 8..116 37..145 161 31.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15782-PB 140 GA15782-PB 3..140 16..145 166 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20665-PA 149 GM20665-PA 2..149 1..148 676 84.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10139-PA 159 GD10139-PA 2..148 1..147 650 83 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19321-PA 147 GK19321-PA 35..138 38..140 229 44.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22785-PA 151 GE22785-PA 2..148 1..148 533 72.3 Plus

IP20690.hyp Sequence

Translation from 0 to 446

> IP20690.hyp
GRAVKNNRVRSAHCNSAAKATSISGHSMLKQNNDCNGRNPFFQFLAYFRK
CSNNCLGHLPSDRVTLIAGKVWNYMSLSEKEPFIAAARRFNYTYRSRSRK
VNWVLAQLRKSAAGEECRPQAQWMLMNFLKSWQESVVRNLLDLDHNQN*

IP20690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30356-PA 149 CG30356-PA 2..149 1..148 793 100 Plus