Clone IP20706 Report

Search the DGRC for IP20706

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:207
Well:6
Vector:pOT2
Associated Gene/TranscriptCG33228-RB
Protein status:IP20706.pep: gold
Sequenced Size:830

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33228 2008-05-05 Release 5.5 slip selected
CG33228 2008-08-15 Release 5.9 accounting
CG33228 2008-12-18 5.12 accounting

Clone Sequence Records

IP20706.complete Sequence

830 bp assembled on 2008-05-14

GenBank Submission: BT032951

> IP20706.complete
AGACCTTCTTCTTTGACAACCATCGGGTAGTGCCGCTGATTGCAGCACAG
CTGATCACGTTGCCAGATTGTTTTCAAAGACAGCATAATAAAACACAAAA
TGTGTGCGGCCCTCTTACGAAGTGTTAAATTGGTTTATTTACGGCCAATA
CTAGCTAAACCGAATTTCCAGCTCTTACACACCAGCAGCGTGCTCCGCAA
ATGGCGGAATGCATCCTCCGGCGAAGTGGAACGGAAGCTCCTCTTTGGCG
ACAGGCTACCAGATAACTATAAACTGATTTACCGGGCCCCTATCGAGAGC
TACGTGACCTGGACGAAGAATATATCCACTGCCACGACCACTGTACTTGC
TGCGGTGGCCGCCTATCACTATGCCACAACCATAAACTACCTGGATATGG
TCCAGAAAATGGACATAGCCATTCTGGTGTCCCAGGAATCAGATCTGTAC
TACTTTGTGGGTGGATTTCTGCTTATAAACCTGGCGATTCGAGCTTTTGT
CGCCAAATATCCACTGAGAATATACAAGAGCTCGGAAAAATACGTGGCTG
TCTATGGGTCCCAACTACCCATTGGAACTGTAAAACACTATTTTGAACGC
GGTCAAATAGCTGAATACAAGAATTTTTTAAATCCCTGGAGCCACATTAT
GTACAAACTGGGCAACCGCTCCTCAATGCTTCTGGTTGATTACTTCAAGA
CCCCCTCGGAGTTCCACCAACTGTTCGCGACCAAACAAGAAACGTAGACT
TTTTAATTGTTGATAATTGTTACAAATAAAATGTTAAAAACATTTTTTGA
AATGTTTGTAAAAAAAAAAAAAAAAAAAAA

IP20706.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33228-RB 809 CG33228-RB 1..809 1..809 4045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20554629..20554988 539..180 1800 100 Minus
chr2R 21145070 chr2R 20554303..20554572 809..540 1350 100 Minus
chr2R 21145070 chr2R 20555044..20555222 179..1 895 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24668737..24669096 539..180 1800 100 Minus
2R 25286936 2R 24668408..24668680 812..540 1365 100 Minus
2R 25286936 2R 24669152..24669330 179..1 895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24669936..24670295 539..180 1800 100 Minus
2R 25260384 2R 24669607..24669879 812..540 1365 100 Minus
2R 25260384 2R 24670351..24670529 179..1 895 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:29:06 has no hits.

IP20706.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:11 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20554303..20554572 540..809 100 <- Minus
chr2R 20554629..20554988 180..539 100 <- Minus
chr2R 20555044..20555222 1..179 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:31 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RA 123..690 180..747 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:32 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..648 100..747 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:15:51 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..648 100..747 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:47 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RA 123..690 180..747 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:32 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..648 100..747 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:34 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RA 123..690 180..747 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:32 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..809 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:15:51 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..809 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:47 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RA 123..690 180..747 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:32 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
CG33228-RB 1..809 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:11 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24669152..24669330 1..179 100   Minus
2R 24668411..24668680 540..809 100 <- Minus
2R 24668737..24669096 180..539 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:11 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24669152..24669330 1..179 100   Minus
2R 24668411..24668680 540..809 100 <- Minus
2R 24668737..24669096 180..539 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:11 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24669152..24669330 1..179 100   Minus
2R 24668411..24668680 540..809 100 <- Minus
2R 24668737..24669096 180..539 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:15:51 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20555934..20556203 540..809 100 <- Minus
arm_2R 20556260..20556619 180..539 100 <- Minus
arm_2R 20556675..20556853 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:27 Download gff for IP20706.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24669628..24669897 540..809 100 <- Minus
2R 24669954..24670313 180..539 100 <- Minus
2R 24670369..24670547 1..179 100   Minus

IP20706.hyp Sequence

Translation from 99 to 746

> IP20706.hyp
MCAALLRSVKLVYLRPILAKPNFQLLHTSSVLRKWRNASSGEVERKLLFG
DRLPDNYKLIYRAPIESYVTWTKNISTATTTVLAAVAAYHYATTINYLDM
VQKMDIAILVSQESDLYYFVGGFLLINLAIRAFVAKYPLRIYKSSEKYVA
VYGSQLPIGTVKHYFERGQIAEYKNFLNPWSHIMYKLGNRSSMLLVDYFK
TPSEFHQLFATKQET*

IP20706.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33228-PC 215 CG33228-PC 1..215 1..215 1107 100 Plus
CG33228-PB 215 CG33228-PB 1..215 1..215 1107 100 Plus

IP20706.pep Sequence

Translation from 99 to 746

> IP20706.pep
MCAALLRSVKLVYLRPILAKPNFQLLHTSSVLRKWRNASSGEVERKLLFG
DRLPDNYKLIYRAPIESYVTWTKNISTATTTVLAAVAAYHYATTINYLDM
VQKMDIAILVSQESDLYYFVGGFLLINLAIRAFVAKYPLRIYKSSEKYVA
VYGSQLPIGTVKHYFERGQIAEYKNFLNPWSHIMYKLGNRSSMLLVDYFK
TPSEFHQLFATKQET*

IP20706.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11911-PA 213 GF11911-PA 1..213 1..213 906 78.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19901-PA 215 GG19901-PA 1..215 1..215 1038 90.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21567-PA 215 GH21567-PA 1..215 1..214 780 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33228-PC 215 CG33228-PC 1..215 1..215 1107 100 Plus
CG33228-PB 215 CG33228-PB 1..215 1..215 1107 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19539-PA 120 GI19539-PA 1..119 95..213 464 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17168-PA 131 GL17168-PA 1..131 82..212 571 77.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25019-PB 210 GA25019-PB 1..210 1..212 804 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11801-PA 215 GM11801-PA 1..214 1..214 1107 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24927-PA 215 GD24927-PA 1..215 1..215 1114 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21110-PA 120 GJ21110-PA 1..119 95..213 518 75.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11425-PA 215 GE11425-PA 1..215 1..215 1061 92.1 Plus