IP20720.complete Sequence
346 bp assembled on 2008-12-10
GenBank Submission: BT053714.1
> IP20720.complete
AGAAGAACATTCTAATAATGGCTCAAATTAAAGGATTGTTTGCTCTCCTC
GCTGTGGTGACCATTGTCCTAATGGTGGCCAACTCGGCTTCGGCCGTGGA
TTGCCCATCTGGAAGATTCAGTGGTCCTTGCTGGGCCTGGGATGGAGAGC
AGTGCCGTCGCCTCTGCAGGGAGGAAGGACGTGTCAGTGGACACTGCAGT
GCCAGTCTGAAGTGCTGGTGCGAACAATGCTGAGGATCCTCATCGTCCAA
TATGTTTGACACATATGTGTGTCATATGTTTTTTATTGTTTTGAAAAGAA
AAATAAAGAATATACTTCACAGCAAAAAAAAAAAAAAAAAAAAAAA
IP20720.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:15:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
dro4-RA | 309 | dro4-RA | 1..309 | 18..326 | 1545 | 100 | Plus |
dro3-RA | 361 | dro3-RA | 58..252 | 37..231 | 450 | 82 | Plus |
dro2-RA | 334 | dro2-RA | 158..239 | 152..233 | 215 | 84.1 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:46:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3315026..3315346 | 1..323 | 1445 | 97.2 | Plus |
chr3L | 24539361 | chr3L | 3314464..3314656 | 39..231 | 455 | 82.4 | Plus |
chr3L | 24539361 | chr3L | 3316382..3316440 | 165..223 | 205 | 89.8 | Plus |
chr3L | 24539361 | chr3L | 3313914..3313995 | 152..233 | 200 | 82.9 | Plus |
chr3L | 24539361 | chr3L | 3369187..3369253 | 165..231 | 185 | 85.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:46:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3315620..3315945 | 1..326 | 1630 | 100 | Plus |
3L | 28110227 | 3L | 3315053..3315247 | 37..231 | 450 | 82.1 | Plus |
3L | 28110227 | 3L | 3314506..3314587 | 152..233 | 215 | 84.1 | Plus |
3L | 28110227 | 3L | 3316976..3317034 | 165..223 | 205 | 89.8 | Plus |
3L | 28110227 | 3L | 3369763..3369829 | 165..231 | 185 | 85.1 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3315620..3315945 | 1..326 | 1630 | 100 | Plus |
3L | 28103327 | 3L | 3315053..3315247 | 37..231 | 450 | 82 | Plus |
3L | 28103327 | 3L | 3314506..3314587 | 152..233 | 215 | 84.1 | Plus |
3L | 28103327 | 3L | 3316976..3317034 | 165..223 | 205 | 89.8 | Plus |
3L | 28103327 | 3L | 3369763..3369829 | 165..231 | 185 | 85 | Plus |
Blast to na_te.dros performed 2019-03-15 18:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
S2 | 1735 | S2 S2 1735bp | 102..166 | 256..321 | 129 | 68.2 | Plus |
pogo | 2121 | pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). | 2009..2047 | 318..280 | 114 | 76.9 | Minus |
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3408..3517 | 160..270 | 111 | 56.8 | Plus |
IP20720.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:47:28 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3315026..3315346 | 1..323 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:03 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro4-RA | 1..216 | 18..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:05 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro4-RA | 1..216 | 18..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:05 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl4-RA | 1..216 | 18..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl4-RA | 1..216 | 18..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:43:15 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro4-RA | 1..306 | 18..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:04 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro4-RA | 1..306 | 18..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:05 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl4-RA | 1..323 | 1..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl4-RA | 1..323 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3315620..3315942 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3315620..3315942 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3315620..3315942 | 1..323 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:05 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3315620..3315942 | 1..323 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:46 Download gff for
IP20720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3315620..3315942 | 1..323 | 100 | | Plus |
IP20720.pep Sequence
Translation from 2 to 232
> IP20720.pep
KNILIMAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQ
CRRLCREEGRVSGHCSASLKCWCEQC*
IP20720.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 2..69 | 8..76 | 232 | 65.2 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 2..69 | 8..76 | 229 | 63.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15128-PA | 71 | GG15128-PA | 1..71 | 6..76 | 335 | 90.1 | Plus |
Dere\GG15127-PA | 71 | GG15127-PA | 1..71 | 6..76 | 298 | 80.3 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 1..70 | 6..76 | 239 | 63.4 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 1..70 | 6..76 | 238 | 64.8 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 2..69 | 8..76 | 223 | 62.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 6..76 | 394 | 100 | Plus |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 6..76 | 280 | 69 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 6..76 | 263 | 64.8 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 6..76 | 257 | 66.2 | Plus |
Drsl5-PA | 69 | CG10812-PA | 2..69 | 8..76 | 243 | 63.8 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 6..76 | 235 | 61.6 | Plus |
Drsl1-PA | 69 | CG32274-PA | 2..69 | 8..76 | 190 | 50.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14561-PA | 71 | GM14561-PA | 1..71 | 6..76 | 264 | 73.2 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 1..70 | 6..76 | 245 | 64.8 | Plus |
Dsec\GM14569-PA | 72 | GM14569-PA | 1..70 | 6..76 | 239 | 66.2 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 2..69 | 8..76 | 223 | 62.3 | Plus |
Dsec\GM14054-PA | 72 | GM14054-PA | 1..72 | 6..76 | 176 | 61.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\dro4-PA | 71 | GD13753-PA | 1..71 | 6..76 | 367 | 100 | Plus |
Dsim\dro3-PA | 71 | GD13752-PA | 1..71 | 6..76 | 275 | 74.6 | Plus |
Dsim\Drs-PA | 70 | GD13760-PA | 1..70 | 6..76 | 241 | 66.2 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 2..69 | 8..76 | 226 | 63.8 | Plus |
Dsim\dro1-PA | 69 | GD13331-PA | 2..69 | 8..76 | 184 | 53.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21353-PA | 71 | GE21353-PA | 1..71 | 6..76 | 317 | 84.5 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 1..70 | 6..76 | 241 | 66.2 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 1..70 | 6..76 | 228 | 60.6 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 2..69 | 8..76 | 217 | 60.9 | Plus |
Dyak\GE20688-PA | 72 | GE20688-PA | 1..72 | 6..76 | 211 | 57.5 | Plus |
IP20720.hyp Sequence
Translation from 2 to 232
> IP20720.hyp
KNILIMAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQ
CRRLCREEGRVSGHCSASLKCWCEQC*
IP20720.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 6..76 | 394 | 100 | Plus |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 6..76 | 280 | 69 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 6..76 | 263 | 64.8 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 6..76 | 257 | 66.2 | Plus |
Drsl5-PA | 69 | CG10812-PA | 2..69 | 8..76 | 243 | 63.8 | Plus |