Clone IP20720 Report

Search the DGRC for IP20720

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:207
Well:20
Vector:pOT2
Associated Gene/TranscriptDrsl4-RA
Protein status:IP20720.pep: gold
Sequenced Size:346

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dro4 2008-12-18 5.12 accounting

Clone Sequence Records

IP20720.complete Sequence

346 bp assembled on 2008-12-10

GenBank Submission: BT053714.1

> IP20720.complete
AGAAGAACATTCTAATAATGGCTCAAATTAAAGGATTGTTTGCTCTCCTC
GCTGTGGTGACCATTGTCCTAATGGTGGCCAACTCGGCTTCGGCCGTGGA
TTGCCCATCTGGAAGATTCAGTGGTCCTTGCTGGGCCTGGGATGGAGAGC
AGTGCCGTCGCCTCTGCAGGGAGGAAGGACGTGTCAGTGGACACTGCAGT
GCCAGTCTGAAGTGCTGGTGCGAACAATGCTGAGGATCCTCATCGTCCAA
TATGTTTGACACATATGTGTGTCATATGTTTTTTATTGTTTTGAAAAGAA
AAATAAAGAATATACTTCACAGCAAAAAAAAAAAAAAAAAAAAAAA

IP20720.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
dro4-RA 309 dro4-RA 1..309 18..326 1545 100 Plus
dro3-RA 361 dro3-RA 58..252 37..231 450 82 Plus
dro2-RA 334 dro2-RA 158..239 152..233 215 84.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3315026..3315346 1..323 1445 97.2 Plus
chr3L 24539361 chr3L 3314464..3314656 39..231 455 82.4 Plus
chr3L 24539361 chr3L 3316382..3316440 165..223 205 89.8 Plus
chr3L 24539361 chr3L 3313914..3313995 152..233 200 82.9 Plus
chr3L 24539361 chr3L 3369187..3369253 165..231 185 85.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3315620..3315945 1..326 1630 100 Plus
3L 28110227 3L 3315053..3315247 37..231 450 82.1 Plus
3L 28110227 3L 3314506..3314587 152..233 215 84.1 Plus
3L 28110227 3L 3316976..3317034 165..223 205 89.8 Plus
3L 28110227 3L 3369763..3369829 165..231 185 85.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3315620..3315945 1..326 1630 100 Plus
3L 28103327 3L 3315053..3315247 37..231 450 82 Plus
3L 28103327 3L 3314506..3314587 152..233 215 84.1 Plus
3L 28103327 3L 3316976..3317034 165..223 205 89.8 Plus
3L 28103327 3L 3369763..3369829 165..231 185 85 Plus
Blast to na_te.dros performed 2019-03-15 18:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 102..166 256..321 129 68.2 Plus
pogo 2121 pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). 2009..2047 318..280 114 76.9 Minus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3408..3517 160..270 111 56.8 Plus

IP20720.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:47:28 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3315026..3315346 1..323 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:03 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
dro4-RA 1..216 18..233 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:05 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
dro4-RA 1..216 18..233 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:05 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 1..216 18..233 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 1..216 18..233 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:43:15 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
dro4-RA 1..306 18..323 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:04 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
dro4-RA 1..306 18..323 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:05 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 1..323 1..323 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 1..323 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3315620..3315942 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3315620..3315942 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:28 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3315620..3315942 1..323 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:05 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3315620..3315942 1..323 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:46 Download gff for IP20720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3315620..3315942 1..323 100   Plus

IP20720.pep Sequence

Translation from 2 to 232

> IP20720.pep
KNILIMAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQ
CRRLCREEGRVSGHCSASLKCWCEQC*

IP20720.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 2..69 8..76 232 65.2 Plus
Dana\GF10208-PA 69 GF10208-PA 2..69 8..76 229 63.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15128-PA 71 GG15128-PA 1..71 6..76 335 90.1 Plus
Dere\GG15127-PA 71 GG15127-PA 1..71 6..76 298 80.3 Plus
Dere\GG15126-PA 70 GG15126-PA 1..70 6..76 239 63.4 Plus
Dere\GG15135-PA 70 GG15135-PA 1..70 6..76 238 64.8 Plus
Dere\GG15129-PA 69 GG15129-PA 2..69 8..76 223 62.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl4-PA 71 CG32282-PA 1..71 6..76 394 100 Plus
Drsl3-PA 71 CG32283-PA 1..71 6..76 280 69 Plus
Drsl2-PA 70 CG32279-PA 1..70 6..76 263 64.8 Plus
Drs-PA 70 CG10810-PA 1..70 6..76 257 66.2 Plus
Drsl5-PA 69 CG10812-PA 2..69 8..76 243 63.8 Plus
Drsl6-PA 72 CG32268-PA 1..72 6..76 235 61.6 Plus
Drsl1-PA 69 CG32274-PA 2..69 8..76 190 50.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14561-PA 71 GM14561-PA 1..71 6..76 264 73.2 Plus
Dsec\GM14560-PA 70 GM14560-PA 1..70 6..76 245 64.8 Plus
Dsec\GM14569-PA 72 GM14569-PA 1..70 6..76 239 66.2 Plus
Dsec\GM14562-PA 69 GM14562-PA 2..69 8..76 223 62.3 Plus
Dsec\GM14054-PA 72 GM14054-PA 1..72 6..76 176 61.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\dro4-PA 71 GD13753-PA 1..71 6..76 367 100 Plus
Dsim\dro3-PA 71 GD13752-PA 1..71 6..76 275 74.6 Plus
Dsim\Drs-PA 70 GD13760-PA 1..70 6..76 241 66.2 Plus
Dsim\dro5-PA 69 GD13754-PA 2..69 8..76 226 63.8 Plus
Dsim\dro1-PA 69 GD13331-PA 2..69 8..76 184 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21353-PA 71 GE21353-PA 1..71 6..76 317 84.5 Plus
Dyak\GE21361-PA 70 GE21361-PA 1..70 6..76 241 66.2 Plus
Dyak\GE21352-PA 70 GE21352-PA 1..70 6..76 228 60.6 Plus
Dyak\GE21355-PA 69 GE21355-PA 2..69 8..76 217 60.9 Plus
Dyak\GE20688-PA 72 GE20688-PA 1..72 6..76 211 57.5 Plus

IP20720.hyp Sequence

Translation from 2 to 232

> IP20720.hyp
KNILIMAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQ
CRRLCREEGRVSGHCSASLKCWCEQC*

IP20720.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl4-PA 71 CG32282-PA 1..71 6..76 394 100 Plus
Drsl3-PA 71 CG32283-PA 1..71 6..76 280 69 Plus
Drsl2-PA 70 CG32279-PA 1..70 6..76 263 64.8 Plus
Drs-PA 70 CG10810-PA 1..70 6..76 257 66.2 Plus
Drsl5-PA 69 CG10812-PA 2..69 8..76 243 63.8 Plus