BDGP Sequence Production Resources |
Search the DGRC for IP20734
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 207 |
Well: | 34 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33977-RA |
Protein status: | IP20734.pep: gold |
Sequenced Size: | 434 |
Gene | Date | Evidence |
---|---|---|
CG33977 | 2008-05-05 | Release 5.5 slip selected |
CG33977 | 2008-08-15 | Release 5.9 accounting |
CG33977 | 2008-12-18 | 5.12 accounting |
434 bp assembled on 2008-05-14
GenBank Submission: BT032764
> IP20734.complete TACGTGTAGAACTTTATTTTCGGTTTAGTTTTGTTTACCAATAAATTTCG TTAGCTATGACAAATCTACAACGCTGGCTATTTTACGCATCGCTCTTTGC GATTCCCTATCTCTCCGTTGTTTTGGGAACAGTGCAAACGCCACTAACTA CCAAGTATTTCCTGCACATTCAGCTTTTACCACTTTTGCTCCTCGTGATT TTTGGAATATATTCCGTTTGGACTGTTCTATATAGAACTCTGACTTTTAA CGATTGTCCCGAGGCCGCCAAGGAGCTGCAGGATGAAATTCAGGAGGCTC GCAAGGATTTGATAGCCAAGGGATTTCGGTTTCGAGATTAGGAGACTTCC AGCTCGTAGGACTTGTGCATGTTAATCTGTAATTCCATTATTTATAAAAA CAAAAATTACGCAAATTTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33977-RA | 698 | CG33977-RA | 126..544 | 1..419 | 2095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9227781..9227987 | 207..418 | 96 | <- | Minus |
chr3R | 9228056..9228261 | 1..206 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..285 | 57..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..285 | 57..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..285 | 57..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..285 | 57..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..285 | 57..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 6..423 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 6..423 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 1..403 | 16..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 6..423 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33977-RA | 8..425 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13402559..13402770 | 207..418 | 100 | <- | Minus |
3R | 13402839..13403044 | 1..206 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13402559..13402770 | 207..418 | 100 | <- | Minus |
3R | 13402839..13403044 | 1..206 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13402559..13402770 | 207..418 | 100 | <- | Minus |
3R | 13402839..13403044 | 1..206 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9228281..9228492 | 207..418 | 100 | <- | Minus |
arm_3R | 9228561..9228766 | 1..206 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13143390..13143601 | 207..418 | 100 | <- | Minus |
3R | 13143670..13143875 | 1..206 | 100 | Minus |
Translation from 56 to 340
> IP20734.pep MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17382-PA | 94 | GF17382-PA | 1..94 | 1..94 | 359 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17053-PA | 94 | GG17053-PA | 1..94 | 1..94 | 453 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18544-PA | 94 | GH18544-PA | 1..94 | 1..94 | 374 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33977-PA | 94 | CG33977-PA | 1..94 | 1..94 | 485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23243-PA | 94 | GI23243-PA | 1..94 | 1..94 | 383 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23063-PA | 94 | GL23063-PA | 1..94 | 1..94 | 353 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24051-PA | 94 | GA24051-PA | 1..94 | 1..94 | 353 | 88.3 | Plus |
Dpse\GA27130-PA | 94 | GA27130-PA | 1..94 | 1..94 | 343 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25938-PA | 94 | GM25938-PA | 1..94 | 1..94 | 467 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20499-PA | 387 | GD20499-PA | 344..387 | 51..94 | 236 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10740-PA | 94 | GJ10740-PA | 1..94 | 1..94 | 369 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13345-PA | 94 | GK13345-PA | 1..94 | 1..94 | 427 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24441-PA | 94 | GE24441-PA | 1..94 | 1..94 | 467 | 94.7 | Plus |
Translation from 56 to 340
> IP20734.hyp MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33977-PA | 94 | CG33977-PA | 1..94 | 1..94 | 485 | 100 | Plus |