Clone IP20734 Report

Search the DGRC for IP20734

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:207
Well:34
Vector:pOT2
Associated Gene/TranscriptCG33977-RA
Protein status:IP20734.pep: gold
Sequenced Size:434

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33977 2008-05-05 Release 5.5 slip selected
CG33977 2008-08-15 Release 5.9 accounting
CG33977 2008-12-18 5.12 accounting

Clone Sequence Records

IP20734.complete Sequence

434 bp assembled on 2008-05-14

GenBank Submission: BT032764

> IP20734.complete
TACGTGTAGAACTTTATTTTCGGTTTAGTTTTGTTTACCAATAAATTTCG
TTAGCTATGACAAATCTACAACGCTGGCTATTTTACGCATCGCTCTTTGC
GATTCCCTATCTCTCCGTTGTTTTGGGAACAGTGCAAACGCCACTAACTA
CCAAGTATTTCCTGCACATTCAGCTTTTACCACTTTTGCTCCTCGTGATT
TTTGGAATATATTCCGTTTGGACTGTTCTATATAGAACTCTGACTTTTAA
CGATTGTCCCGAGGCCGCCAAGGAGCTGCAGGATGAAATTCAGGAGGCTC
GCAAGGATTTGATAGCCAAGGGATTTCGGTTTCGAGATTAGGAGACTTCC
AGCTCGTAGGACTTGTGCATGTTAATCTGTAATTCCATTATTTATAAAAA
CAAAAATTACGCAAATTTAAAAAAAAAAAAAAAA

IP20734.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-RA 698 CG33977-RA 126..544 1..419 2095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9228057..9228261 205..1 980 98.5 Minus
chr3R 27901430 chr3R 9227781..9227987 418..207 920 96.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13402558..13402770 419..207 1065 100 Minus
3R 32079331 3R 13402839..13403044 206..1 1030 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13143389..13143601 419..207 1065 100 Minus
3R 31820162 3R 13143670..13143875 206..1 1030 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:36:27 has no hits.

IP20734.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:37:15 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9227781..9227987 207..418 96 <- Minus
chr3R 9228056..9228261 1..206 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:36 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..285 57..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:00 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..285 57..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:24:59 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..285 57..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:19 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..285 57..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:07:54 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..285 57..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:52 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 6..423 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:00 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 6..423 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:24:59 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 1..403 16..418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:19 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 6..423 1..418 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:07:54 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 8..425 1..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:15 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13402559..13402770 207..418 100 <- Minus
3R 13402839..13403044 1..206 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:15 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13402559..13402770 207..418 100 <- Minus
3R 13402839..13403044 1..206 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:15 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13402559..13402770 207..418 100 <- Minus
3R 13402839..13403044 1..206 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:24:59 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9228281..9228492 207..418 100 <- Minus
arm_3R 9228561..9228766 1..206 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:45 Download gff for IP20734.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13143390..13143601 207..418 100 <- Minus
3R 13143670..13143875 1..206 100   Minus

IP20734.pep Sequence

Translation from 56 to 340

> IP20734.pep
MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG
IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRD*

IP20734.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17382-PA 94 GF17382-PA 1..94 1..94 359 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17053-PA 94 GG17053-PA 1..94 1..94 453 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18544-PA 94 GH18544-PA 1..94 1..94 374 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-PA 94 CG33977-PA 1..94 1..94 485 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23243-PA 94 GI23243-PA 1..94 1..94 383 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23063-PA 94 GL23063-PA 1..94 1..94 353 88.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24051-PA 94 GA24051-PA 1..94 1..94 353 88.3 Plus
Dpse\GA27130-PA 94 GA27130-PA 1..94 1..94 343 87.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25938-PA 94 GM25938-PA 1..94 1..94 467 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20499-PA 387 GD20499-PA 344..387 51..94 236 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10740-PA 94 GJ10740-PA 1..94 1..94 369 86.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13345-PA 94 GK13345-PA 1..94 1..94 427 86.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24441-PA 94 GE24441-PA 1..94 1..94 467 94.7 Plus

IP20734.hyp Sequence

Translation from 56 to 340

> IP20734.hyp
MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG
IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRD*

IP20734.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-PA 94 CG33977-PA 1..94 1..94 485 100 Plus