Clone IP20801 Report

Search the DGRC for IP20801

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:208
Well:1
Vector:pOT2
Associated Gene/TranscriptCG33252-RA
Protein status:IP20801.pep: gold
Sequenced Size:867

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33252 2008-05-05 Release 5.5 slip selected
CG33252 2008-08-15 Release 5.9 accounting
CG33252 2008-12-18 5.12 accounting

Clone Sequence Records

IP20801.complete Sequence

867 bp assembled on 2008-05-27

GenBank Submission: BT032767

> IP20801.complete
CTTTGACTTGATCGAATCACTTATTTATATATTCTCTCTGAGATCTTTAT
AAATTTCGAAAATTTTCTTTGTACAAACTTACCTCATTTCGCAATGTATT
TCTTCGAGAAGATCAGTGATCAGTTTTGCCGCGTTGTGCGCACCAACCTA
AATATACCACTATCCTTTTGCGAAACACGGAACGTCTGGAAATTCTCGAA
CACTTCCGATACAATGATATTCTTCTTCACCCTCACCTTTGGTATCCTTC
GAGCGTTCTCAAATTTTATAGATTTCATGAACCTTTTCTTCGGAGGGATG
CGTTTGGGGCGGCCAAGCAATCTCTTGATTTTGAGGGGCGAAAATTCGCG
CCGCTTTCAAGTCATCAAACACTTTTTAATGCTGAATGCATGGATATTAG
TGATATACGCCATGGTATTTATCAAGCCGCATTACATGGTTCCCTTCGTT
GTGCTTTCGTTGATCATCTTGATCATCTATGTGTTCGTCGTGGCATTAGA
TATCCTGCGACATGTCGGGATACCACTGGACCGCAAGATGATCCTTTCGG
AAATGATCCTCAACTTGAGCTGTGTTGTTTACGTGCAGGGGGTCCTCAAG
CAACAGATCTTCTCTTAGTGGACGAATTTTTTGGTTTTGAAGAAATGCTG
GTTGAATGGATGGTTAATATTGGCATTACGCTGCCAAGCAAAACAGTTAC
TATATTCTATGATTGGCAATTATTACGCCTAAGTTAAGTTATTACGTTCT
TCTTGTTTCGTTGTCAAAAACATATTATAAATACTTACACATTGATGAAA
AATAAAACCATTAACAACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

IP20801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33252-RA 880 CG33252-RA 49..869 1..821 4105 100 Plus
CG32588-RA 694 CG32588-RA 101..295 100..294 405 80.5 Plus
CG32588-RA 694 CG32588-RA 297..418 311..432 220 78.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16785845..16786243 819..421 1980 99.7 Minus
chrX 22417052 chrX 16786563..16786817 255..1 1215 98.4 Minus
chrX 22417052 chrX 16786319..16786484 420..255 830 100 Minus
chrX 22417052 chrX 15111064..15111269 253..47 505 84.1 Minus
chrX 22417052 chrX 15110819..15110975 419..263 500 87.9 Minus
chrX 22417052 chrX 15110536..15110747 632..421 490 82.1 Minus
chrX 22417052 chrX 15096505..15096657 252..100 300 79.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16896213..16896613 821..421 2005 100 Minus
X 23542271 X 16896933..16897187 255..1 1275 100 Minus
X 23542271 X 16896689..16896854 420..255 830 100 Minus
X 23542271 X 15220939..15221144 253..47 505 84.1 Minus
X 23542271 X 15220694..15220850 419..263 500 87.9 Minus
X 23542271 X 15220411..15220622 632..421 475 81.6 Minus
X 23542271 X 15206397..15206549 252..100 300 79.7 Minus
X 23542271 X 15206169..15206278 420..311 190 78.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16904311..16904711 821..421 2005 100 Minus
X 23527363 X 16905031..16905285 255..1 1275 100 Minus
X 23527363 X 16904787..16904952 420..255 830 100 Minus
X 23527363 X 15228792..15228948 419..263 500 87.8 Minus
X 23527363 X 15228509..15228720 632..421 475 81.6 Minus
X 23527363 X 15229111..15229242 179..47 370 86.4 Minus
X 23527363 X 15214495..15214647 252..100 300 79.7 Minus
X 23527363 X 15229037..15229104 253..186 205 86.7 Minus
X 23527363 X 15214267..15214376 420..311 190 78.1 Minus
X 23527363 X 15214378..15214411 294..261 140 94.1 Minus
Blast to na_te.dros performed on 2019-03-16 16:43:56 has no hits.

IP20801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:45:08 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16786563..16786817 1..255 98   Minus
chrX 16785845..16786243 421..819 99 <- Minus
chrX 16786319..16786483 256..420 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:44 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..525 94..618 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:39:55 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..525 94..618 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:42:58 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..525 94..618 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:06 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..525 94..618 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:39:18 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..525 94..618 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:37 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..625 14..638 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:39:55 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..625 14..638 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:42:58 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..819 1..819 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:46:06 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..625 14..638 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:39:18 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
CG33252-RA 1..819 1..819 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:08 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
X 16896215..16896613 421..819 100 <- Minus
X 16896689..16896853 256..420 100 <- Minus
X 16896933..16897187 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:08 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
X 16896215..16896613 421..819 100 <- Minus
X 16896689..16896853 256..420 100 <- Minus
X 16896933..16897187 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:08 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
X 16896215..16896613 421..819 100 <- Minus
X 16896689..16896853 256..420 100 <- Minus
X 16896933..16897187 1..255 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:42:58 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16790966..16791220 1..255 100   Minus
arm_X 16790248..16790646 421..819 100 <- Minus
arm_X 16790722..16790886 256..420 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:00 Download gff for IP20801.complete
Subject Subject Range Query Range Percent Splice Strand
X 16904313..16904711 421..819 100 <- Minus
X 16904787..16904951 256..420 100 <- Minus
X 16905031..16905285 1..255 100   Minus

IP20801.hyp Sequence

Translation from 93 to 617

> IP20801.hyp
MYFFEKISDQFCRVVRTNLNIPLSFCETRNVWKFSNTSDTMIFFFTLTFG
ILRAFSNFIDFMNLFFGGMRLGRPSNLLILRGENSRRFQVIKHFLMLNAW
ILVIYAMVFIKPHYMVPFVVLSLIILIIYVFVVALDILRHVGIPLDRKMI
LSEMILNLSCVVYVQGVLKQQIFS*

IP20801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33252-PA 174 CG33252-PA 1..174 1..174 892 100 Plus
CG43075-PA 174 CG43075-PA 1..172 1..172 633 71.5 Plus
CG32588-PA 170 CG32588-PA 1..169 1..173 420 52.3 Plus
CG9030-PB 210 CG9030-PB 1..192 1..172 212 28.4 Plus

IP20801.pep Sequence

Translation from 93 to 617

> IP20801.pep
MYFFEKISDQFCRVVRTNLNIPLSFCETRNVWKFSNTSDTMIFFFTLTFG
ILRAFSNFIDFMNLFFGGMRLGRPSNLLILRGENSRRFQVIKHFLMLNAW
ILVIYAMVFIKPHYMVPFVVLSLIILIIYVFVVALDILRHVGIPLDRKMI
LSEMILNLSCVVYVQGVLKQQIFS*

IP20801.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19426-PA 206 GG19426-PA 1..194 1..172 274 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG33252-PA 174 CG33252-PA 1..174 1..174 892 100 Plus
CG43075-PA 174 CG43075-PA 1..172 1..172 633 71.5 Plus
CG32588-PA 170 CG32588-PA 1..169 1..173 420 52.3 Plus
CG9030-PB 210 CG9030-PB 1..192 1..172 212 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11999-PA 174 GM11999-PA 1..172 1..172 554 63.4 Plus
Dsec\GM11997-PA 174 GM11997-PA 1..172 1..172 538 62.2 Plus
Dsec\GM13355-PA 162 GM13355-PA 1..159 1..171 468 59.1 Plus
Dsec\GM13356-PA 162 GM13356-PA 1..159 1..171 468 59.1 Plus
Dsec\GM13354-PA 162 GM13354-PA 1..159 1..171 468 59.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24501-PA 174 GD24501-PA 1..172 1..172 570 65.7 Plus
Dsim\GD15816-PA 172 GD15816-PA 1..171 1..171 539 63.2 Plus
Dsim\GD24640-PA 161 GD24640-PA 1..161 1..173 426 54.9 Plus
Dsim\GD15713-PA 162 GD15713-PA 1..159 1..171 423 54.4 Plus
Dsim\GD15714-PA 155 GD15714-PA 1..129 1..141 366 57.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16063-PA 180 GE16063-PA 6..177 6..172 323 39 Plus
Dyak\GE16065-PA 180 GE16065-PA 6..177 6..172 313 39 Plus
Dyak\GE16078-PA 205 GE16078-PA 1..193 1..172 174 28.4 Plus