Clone IP20810 Report

Search the DGRC for IP20810

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:208
Well:10
Vector:pOT2
Associated Gene/TranscriptCG14518-RA
Protein status:IP20810.pep: gold
Sequenced Size:687

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14518 2008-05-05 Release 5.5 slip selected
CG14518 2008-08-15 Release 5.9 accounting
CG14518 2008-12-18 5.12 accounting

Clone Sequence Records

IP20810.complete Sequence

687 bp assembled on 2008-05-22

GenBank Submission: BT032768

> IP20810.complete
CATGAAAATAGTGCTGGTTATTTGGATGCTAGCTCACTCACTTCAGCCGC
CTTATCAATGTGATGCTGTCATTTTCAAAATGACCAATGCAGTATGTGAG
ACCTATAACAAATCCTGGGTGGAATTCGGGTTGTGCCGCCTGCGTGCTGT
TAGCAGGAATAAGGTTTGCCTCAATGTCGATGCCAATTTGCTGCATCCGG
TTCACGATGTCATAGTCAAGGCCAGATTGCTGAAGAGGGCCAATGGCTAT
AAGCCTTGGCTATATAGCGTCAGTTTCGACGGCTGTCAGTTTATAAGGCG
GAGAAATAATGCCTTGATTCGGATCGTTTGGGAGCTCTTCAAAGAGTACT
CGACGATCAATCACACCTGTCCCTATGTGGGCCTGCAGCAAGTCAAGAAC
TTCTATCTCAGGTCCGAGAAGCTGCCCACGCCCATTCCCACTGGAGAATA
TCTGCTGATGATTGACTGGGTGTTCAACAAGAAACCGCAGGCTGCCACAA
ATGTTTACTTCACATTTGTGGAGGACCTAAAAGATAGTTAACGAATCAAT
CGTTCAGACCAAAATGTTTAAACTGAACTGTAATTACAAAATAAACAATA
TAAGTCTATATTGTTTTAGCCGATGAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP20810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14518-RA 633 CG14518-RA 9..633 1..625 3125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24848056..24848374 62..380 1595 100 Plus
chr3R 27901430 chr3R 24848882..24849128 379..625 1235 100 Plus
chr3R 27901430 chr3R 24847940..24848001 1..62 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:43:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29025087..29025405 62..380 1595 100 Plus
3R 32079331 3R 29025913..29026163 379..629 1255 100 Plus
3R 32079331 3R 29024971..29025032 1..62 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28765918..28766236 62..380 1595 100 Plus
3R 31820162 3R 28766744..28766994 379..629 1255 100 Plus
3R 31820162 3R 28765802..28765863 1..62 310 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:15:54 has no hits.

IP20810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:16:31 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24847940..24848000 1..61 100 -> Plus
chr3R 24848056..24848373 62..379 100 -> Plus
chr3R 24848883..24849128 380..625 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:46 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:56 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:20 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:44 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:49 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:11 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:55 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..625 1..625 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:20 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..625 1..625 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:45 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..540 2..541 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:49 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14518-RA 1..625 1..625 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:31 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29024971..29025031 1..61 100 -> Plus
3R 29025087..29025404 62..379 100 -> Plus
3R 29025914..29026159 380..625 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:31 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29024971..29025031 1..61 100 -> Plus
3R 29025087..29025404 62..379 100 -> Plus
3R 29025914..29026159 380..625 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:31 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29024971..29025031 1..61 100 -> Plus
3R 29025087..29025404 62..379 100 -> Plus
3R 29025914..29026159 380..625 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:20 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24850693..24850753 1..61 100 -> Plus
arm_3R 24850809..24851126 62..379 100 -> Plus
arm_3R 24851636..24851881 380..625 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:21 Download gff for IP20810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28765918..28766235 62..379 100 -> Plus
3R 28766745..28766990 380..625 100   Plus
3R 28765802..28765862 1..61 100 -> Plus

IP20810.hyp Sequence

Translation from 0 to 540

> IP20810.hyp
MKIVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAV
SRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRR
RNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEY
LLMIDWVFNKKPQAATNVYFTFVEDLKDS*

IP20810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14518-PA 179 CG14518-PA 1..179 1..179 965 100 Plus
CG33725-PC 175 CG33725-PC 17..172 21..176 499 55.8 Plus
CG33725-PA 181 CG33725-PA 23..178 21..176 499 55.8 Plus
CG13589-PA 174 CG13589-PA 21..174 21..176 474 51.3 Plus
CG13590-PA 193 CG13590-PA 5..174 7..176 468 49.4 Plus

IP20810.pep Sequence

Translation from 1 to 540

> IP20810.pep
MKIVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAV
SRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRR
RNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEY
LLMIDWVFNKKPQAATNVYFTFVEDLKDS*

IP20810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16267-PA 385 GF16267-PA 205..385 9..179 769 77.9 Plus
Dana\GF19957-PA 158 GF19957-PA 1..156 21..176 496 54.5 Plus
Dana\GF11248-PA 148 GF11248-PA 1..148 27..176 478 54 Plus
Dana\GF18912-PA 166 GF18912-PA 1..159 21..179 446 50.9 Plus
Dana\GF18140-PA 152 GF18140-PA 1..150 27..176 422 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19926-PA 155 GG19926-PA 1..148 27..176 472 52 Plus
Dere\GG19924-PA 181 GG19924-PA 21..174 21..176 472 50 Plus
Dere\GG13491-PA 179 GG13491-PA 5..178 1..176 449 45.5 Plus
Dere\GG19928-PA 175 GG19928-PA 21..174 21..176 429 53.2 Plus
Dere\GG15994-PA 179 GG15994-PA 25..178 23..176 426 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20374-PA 159 GH20374-PA 6..156 26..176 467 53.6 Plus
Dgri\GH21518-PA 176 GH21518-PA 21..176 21..176 457 49.4 Plus
Dgri\GH22194-PA 150 GH22194-PA 1..150 27..176 452 53.3 Plus
Dgri\GH20381-PA 150 GH20381-PA 1..150 27..176 452 53.3 Plus
Dgri\GH20380-PA 150 GH20380-PA 1..150 27..176 443 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14518-PA 179 CG14518-PA 1..179 1..179 965 100 Plus
CG33725-PC 175 CG33725-PC 17..172 21..176 499 55.8 Plus
CG33725-PA 181 CG33725-PA 23..178 21..176 499 55.8 Plus
CG13589-PA 174 CG13589-PA 21..174 21..176 474 51.3 Plus
CG13590-PA 193 CG13590-PA 5..174 7..176 468 49.4 Plus
CG33453-PB 174 CG33453-PB 21..173 21..175 437 47.7 Plus
CG33795-PB 178 CG33795-PB 15..177 5..176 431 43.6 Plus
CG33796-PA 179 CG33796-PA 5..178 1..176 422 42 Plus
CG33453-PA 175 CG33453-PA 23..174 21..175 421 47.1 Plus
CG33454-PA 173 CG33454-PA 21..173 21..176 376 45.5 Plus
CG33927-PA 182 CG33927-PA 28..178 25..175 356 39.7 Plus
CG33632-PA 180 CG33632-PA 25..179 24..172 257 37.8 Plus
CG33757-PA 178 CG33757-PA 12..167 14..167 239 31.4 Plus
CG33798-PA 178 CG33798-PA 20..178 24..176 236 29.4 Plus
CG33923-PB 178 CG33923-PB 25..176 26..171 233 33.3 Plus
CG33777-PA 172 CG33777-PA 16..170 23..171 230 34 Plus
CG33928-PA 180 CG33928-PA 28..179 26..172 230 33.3 Plus
CG33922-PA 178 CG33922-PA 25..174 26..169 223 34 Plus
CG33658-PA 181 CG33658-PA 29..178 26..170 218 29.8 Plus
CG33483-PA 179 CG33483-PA 22..177 22..171 217 33.1 Plus
CG33764-PA 180 CG33764-PA 25..178 24..171 217 32.5 Plus
CG33483-PB 229 CG33483-PB 72..227 22..171 217 33.1 Plus
CG33758-PA 178 CG33758-PA 20..167 26..167 215 30.4 Plus
CG33648-PC 178 CG33648-PC 19..176 21..171 215 32.3 Plus
CG33700-PC 175 CG33700-PC 23..170 25..169 211 27.7 Plus
CG13561-PB 176 CG13561-PB 22..174 24..174 210 33.1 Plus
CG33689-PB 178 CG33689-PB 24..175 28..174 209 28.9 Plus
CG33648-PB 177 CG33648-PB 23..175 26..171 208 32 Plus
CG33687-PB 169 CG33687-PB 15..165 28..170 207 27.2 Plus
CG33690-PA 170 CG33690-PA 24..164 28..169 207 31.8 Plus
CG33723-PA 180 CG33723-PA 27..178 26..171 207 30.8 Plus
CG33463-PA 157 CG33463-PA 1..139 24..156 204 31.4 Plus
CG33679-PA 173 CG33679-PA 20..152 26..155 202 33.1 Plus
CG33654-PA 168 CG33654-PA 26..166 25..171 199 27 Plus
CG33773-PA 179 CG33773-PA 25..177 25..171 195 30.1 Plus
CG33752-PA 185 CG33752-PA 23..177 24..170 190 29.7 Plus
CG33919-PA 191 CG33919-PA 1..150 1..150 190 30.1 Plus
CG33784-PA 183 CG33784-PA 26..157 24..152 188 31.8 Plus
CG33688-PA 175 CG33688-PA 24..169 28..169 186 28.1 Plus
CG33914-PC 189 CG33914-PC 24..187 23..173 183 25.6 Plus
CG33914-PB 189 CG33914-PB 24..187 23..173 183 25.6 Plus
CG33920-PA 180 CG33920-PA 25..178 25..171 182 25.8 Plus
CG13198-PA 180 CG13198-PA 24..180 24..174 180 27.4 Plus
CG33775-PA 182 CG33775-PA 8..162 2..154 176 30.1 Plus
CG12849-PA 172 CG12849-PA 21..170 25..171 173 27.2 Plus
CG33137-PB 193 CG33137-PB 12..141 23..150 172 28.2 Plus
CG33783-PA 164 CG33783-PA 10..139 27..153 169 30.8 Plus
CG34303-PB 181 CG34303-PB 26..174 25..167 169 24.8 Plus
CG33912-PA 165 CG33912-PA 3..163 1..171 168 25.8 Plus
CG33721-PA 181 CG33721-PA 26..179 26..171 162 25.2 Plus
CG33467-PB 188 CG33467-PB 22..153 23..154 160 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23048-PA 151 GI23048-PA 1..150 27..176 478 54 Plus
Dmoj\GI23047-PA 151 GI23047-PA 1..150 27..176 469 52.7 Plus
Dmoj\GI20048-PA 157 GI20048-PA 2..157 22..176 466 55.1 Plus
Dmoj\GI20047-PA 160 GI20047-PA 1..160 21..179 460 52.5 Plus
Dmoj\GI16963-PA 154 GI16963-PA 1..151 27..177 434 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24245-PA 150 GL24245-PA 1..150 27..176 720 87.3 Plus
Dper\GL27198-PA 182 GL27198-PA 23..178 21..176 514 60.3 Plus
Dper\GL23708-PA 175 GL23708-PA 9..174 13..179 513 56.9 Plus
Dper\GL20426-PA 175 GL20426-PA 11..175 3..175 493 50.9 Plus
Dper\GL20428-PA 154 GL20428-PA 1..153 21..175 487 56.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13049-PA 150 GA13049-PA 1..150 27..176 720 87.3 Plus
Dpse\GA26710-PA 175 GA26710-PA 11..174 15..179 531 58.8 Plus
Dpse\GA22436-PA 175 GA22436-PA 11..171 15..176 522 59.3 Plus
Dpse\GA22434-PA 175 GA22434-PA 9..171 13..176 521 56.7 Plus
Dpse\GA24704-PA 175 GA24704-PA 9..171 13..176 516 56.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12752-PA 179 GM12752-PA 1..179 1..179 937 96.1 Plus
Dsec\GM25347-PA 181 GM25347-PA 23..178 21..176 483 53.8 Plus
Dsec\GM11828-PA 174 GM11828-PA 21..173 21..175 470 51 Plus
Dsec\GM11827-PA 193 GM11827-PA 21..174 21..176 468 50.6 Plus
Dsec\GM19845-PA 176 GM19845-PA 23..176 21..176 446 46.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21399-PA 179 GD21399-PA 1..179 1..179 941 97.2 Plus
Dsim\GD14380-PA 181 GD14380-PA 23..178 21..176 489 54.5 Plus
Dsim\GD24948-PA 193 GD24948-PA 21..174 21..176 476 51.9 Plus
Dsim\GD24949-PA 174 GD24949-PA 21..173 21..175 472 51.6 Plus
Dsim\GD24947-PA 148 GD24947-PA 1..147 27..175 436 49.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15147-PA 178 GJ15147-PA 1..178 1..176 489 48.6 Plus
Dvir\GJ21063-PA 148 GJ21063-PA 1..146 27..172 470 56.8 Plus
Dvir\GJ15149-PA 156 GJ15149-PA 1..156 21..176 469 53.2 Plus
Dvir\GJ21065-PA 159 GJ21065-PA 2..156 22..176 467 52.9 Plus
Dvir\GJ21064-PA 151 GJ21064-PA 1..150 27..176 463 50.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21797-PA 184 GK21797-PA 31..181 26..176 517 57.6 Plus
Dwil\GK19198-PA 156 GK19198-PA 1..156 21..176 482 55.1 Plus
Dwil\GK19212-PA 186 GK19212-PA 30..186 21..176 474 51 Plus
Dwil\GK19197-PA 162 GK19197-PA 1..138 21..158 429 55.8 Plus
Dwil\GK13467-PA 181 GK13467-PA 23..181 21..179 405 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23819-PA 178 GE23819-PA 1..178 1..179 898 94.4 Plus
Dyak\GE11454-PA 166 GE11454-PA 1..148 27..176 484 55.3 Plus
Dyak\GE11451-PA 192 GE11451-PA 21..174 21..176 480 52.6 Plus
Dyak\GE11452-PA 166 GE11452-PA 1..148 27..176 476 54.7 Plus
Dyak\GE11453-PA 166 GE11453-PA 1..148 27..176 476 54 Plus