Clone IP20912 Report

Search the DGRC for IP20912

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:209
Well:12
Vector:pOT2
Protein status:IP20912.pep: Imported from assembly
Sequenced Size:867

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33263 2008-05-05 Release 5.5 slip selected
CG33263 2008-08-15 Release 5.9 accounting
CG33263 2008-12-18 5.12 accounting

Clone Sequence Records

IP20912.complete Sequence

867 bp assembled on 2008-05-14

GenBank Submission: BT032770

> IP20912.complete
GTCATTTAAACTATCTTTGCATTGTCTGCTGATCCTGGCAGGATATCTCA
CTTCAATTGAAGCCGAAGTTTTCCCGCAGTGCGCAAATGCTCCATTGGAT
ACCTTTGTCATGGCCATCGAAGATTGCGCTTCATACATCTATTGCAATGG
AGAAGACTCCTTCCGAGACAGCTGCCCCGAGTCCACCTACTTTGACGATC
GAACCCAAGAGTGTGCCTTTGATGATGAGGGTGTGTGTCTAAGGAACTCA
GACTCAGTCCAGACTGAGGAGCAGCCCGATAAGCAAACTACTGGTGAGGA
GCAGAGCGGGATCGAAGAAACCACTCCCGTTCCAACACCGCCTTCTGATT
ACGCCTCTACAGGATCTGCGGACTCTTCTACTTTCCAAGCTGATTCTACA
ACAACCCCTACAGAATCAATTCCTTCAGTGACTGAGCCACCGACTACATC
TGCTACGCCATCCTCCCCATCTGCAAAGCCTTCCTCTCCAGCTCAGGAAA
GGCCGCACTGCGACATTTCCGGAGATGGTGACCATCCTCATCCCCAGCGG
TGCGAGTACTACTACAGGTGCCTCAGCGGCTATCTGACCATTGTGAGATG
TCCTTACAAGTATGGCTGGGACTTTCCTACAAAGCAATGCAAGCCTAGCA
GCGAGGCTCAGTGCTTTAGTTATAGCTACTAGATTTATCTTTAGAAGCTC
AACTTTGATCTAAATAAATTAGATTAGATTAGGCGATCTGTAGGTTGATT
TCAAATCATTTTATTAACTTTTATACATTTATTTATATGTTCTTAAGATG
AGGCTTTAACTTTGATCATAATCAAAAATAAATGAATAATTTCCTGTAAA
AAAAAAAAAAAAAAAAA

IP20912.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG33263-RA 832 CG33263-RA 3..832 1..830 4150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13413553..13414414 847..1 3930 97.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13423319..13424166 848..1 4240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13416419..13417266 848..1 4240 100 Minus
Blast to na_te.dros performed 2019-03-16 16:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3673..3772 800..704 133 63.7 Minus

IP20912.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:55:37 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13413553..13413623 777..847 97 -- Minus
chr3L 13413639..13414414 1..776 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:51 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:36 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:44 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:34 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:46:33 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:41 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:36 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..849 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:44 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..849 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:35 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..684 1..682 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:46:33 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
CG33263-RA 3..849 1..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:37 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13423320..13424166 1..847 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:37 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13423320..13424166 1..847 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:37 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13423320..13424166 1..847 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:44 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13416420..13417266 1..847 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:33:54 Download gff for IP20912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13416420..13417266 1..847 100   Minus

IP20912.hyp Sequence

Translation from 0 to 681

> IP20912.hyp
SFKLSLHCLLILAGYLTSIEAEVFPQCANAPLDTFVMAIEDCASYIYCNG
EDSFRDSCPESTYFDDRTQECAFDDEGVCLRNSDSVQTEEQPDKQTTGEE
QSGIEETTPVPTPPSDYASTGSADSSTFQADSTTTPTESIPSVTEPPTTS
ATPSSPSAKPSSPAQERPHCDISGDGDHPHPQRCEYYYRCLSGYLTIVRC
PYKYGWDFPTKQCKPSSEAQCFSYSY*

IP20912.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG33263-PA 227 CG33263-PA 2..227 1..226 1240 100 Plus
obst-H-PA 269 CG33983-PA 3..251 3..225 238 24.3 Plus
CG33985-PA 277 CG33985-PA 5..268 4..223 232 24.9 Plus
CG7252-PA 474 CG7252-PA 9..207 6..201 176 28.6 Plus
CG42729-PA 185 CG42729-PA 11..172 11..213 159 23.7 Plus

IP20912.pep Sequence

Translation from 1 to 681

> IP20912.pep
SFKLSLHCLLILAGYLTSIEAEVFPQCANAPLDTFVMAIEDCASYIYCNG
EDSFRDSCPESTYFDDRTQECAFDDEGVCLRNSDSVQTEEQPDKQTTGEE
QSGIEETTPVPTPPSDYASTGSADSSTFQADSTTTPTESIPSVTEPPTTS
ATPSSPSAKPSSPAQERPHCDISGDGDHPHPQRCEYYYRCLSGYLTIVRC
PYKYGWDFPTKQCKPSSEAQCFSYSY*

IP20912.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10954-PA 192 GF10954-PA 5..191 3..223 527 51.1 Plus
Dana\GF24464-PA 259 GF24464-PA 3..256 3..225 189 25.8 Plus
Dana\GF19890-PA 232 GF19890-PA 5..216 4..223 181 21.9 Plus
Dana\GF24469-PA 290 GF24469-PA 10..282 11..223 159 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13771-PA 202 GG13771-PA 2..202 1..226 789 71.2 Plus
Dere\GG13541-PA 274 GG13541-PA 14..265 15..223 202 24.5 Plus
Dere\GG11181-PA 221 GG11181-PA 25..203 24..223 194 29.3 Plus
Dere\GG13539-PA 273 GG13539-PA 3..255 3..225 182 23.5 Plus
Dere\GG13542-PA 290 GG13542-PA 54..279 27..221 154 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19629-PA 192 GH19629-PA 17..191 13..223 528 52.6 Plus
Dgri\GH14678-PA 192 GH14678-PA 17..191 13..223 525 52.6 Plus
Dgri\GH16815-PA 281 GH16815-PA 28..273 21..225 170 25.2 Plus
Dgri\GH16813-PA 241 GH16813-PA 6..238 9..225 166 24.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG33263-PA 227 CG33263-PA 2..227 1..226 1240 100 Plus
obst-H-PA 269 CG33983-PA 3..251 3..225 238 24.3 Plus
CG33985-PA 277 CG33985-PA 5..268 4..223 232 24.9 Plus
CG7252-PA 474 CG7252-PA 9..207 6..201 176 28.6 Plus
obst-F-PA 326 CG7306-PA 162..324 41..222 163 26.6 Plus
CG42729-PA 185 CG42729-PA 11..172 11..213 159 23.7 Plus
CG4835-PB 1224 CG4835-PB 51..216 27..200 150 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13788-PA 193 GI13788-PA 8..192 4..223 513 48.4 Plus
Dmoj\GI12216-PA 257 GI12216-PA 11..252 10..223 199 23.1 Plus
Dmoj\GI12221-PA 269 GI12221-PA 36..260 17..221 142 24.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25433-PA 196 GL25433-PA 22..190 20..223 511 51 Plus
Dper\GL25573-PA 271 GL25573-PA 4..268 6..225 186 24.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28616-PA 196 GA28616-PA 22..190 20..223 497 48.3 Plus
Dpse\GA23637-PA 271 GA23637-PA 4..266 6..223 185 24.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24595-PA 227 GM24595-PA 2..227 1..226 1074 89.8 Plus
Dsec\GM24484-PA 276 GM24484-PA 4..267 5..223 187 23.4 Plus
Dsec\GM24482-PA 269 GM24482-PA 3..251 3..225 182 25.8 Plus
Dsec\GM24485-PA 274 GM24485-PA 6..263 1..221 160 25.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12664-PA 226 GD12664-PA 2..224 1..223 1083 92.4 Plus
Dsim\GD12556-PA 276 GD12556-PA 4..267 5..223 189 23.8 Plus
Dsim\GD12557-PA 279 GD12557-PA 8..268 1..221 151 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13591-PA 180 GJ13591-PA 12..179 8..223 537 52.3 Plus
Dvir\GJ11448-PA 252 GJ11448-PA 2..249 2..225 181 26.1 Plus
Dvir\GJ11450-PA 271 GJ11450-PA 22..265 21..222 172 23.9 Plus
Dvir\GJ11451-PA 268 GJ11451-PA 35..259 17..221 170 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17083-PA 194 GK17083-PA 21..192 21..223 496 51.7 Plus
Dwil\GK10516-PA 272 GK10516-PA 5..267 6..223 202 27.6 Plus
Dwil\GK10521-PA 276 GK10521-PA 23..271 22..223 202 25.2 Plus
Dwil\GK19192-PA 240 GK19192-PA 22..225 14..222 159 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20066-PA 223 GE20066-PA 3..223 2..226 876 84.4 Plus
Dyak\GE19842-PA 274 GE19842-PA 11..265 8..223 191 24.2 Plus
Dyak\GE22841-PA 274 GE22841-PA 11..265 8..223 191 24.2 Plus
Dyak\GE22838-PA 271 GE22838-PA 23..253 24..225 164 25.2 Plus
Dyak\GE19840-PA 271 GE19840-PA 23..253 24..225 164 25.2 Plus