Clone IP20969 Report

Search the DGRC for IP20969

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:209
Well:69
Vector:pOT2
Associated Gene/TranscriptCG33462-RA
Protein status:IP20969.pep: gold
Sequenced Size:1033

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33462 2008-05-05 Release 5.5 slip selected
CG33462 2008-08-15 Release 5.9 accounting
CG33462 2008-12-18 5.12 accounting

Clone Sequence Records

IP20969.complete Sequence

1033 bp assembled on 2008-05-14

GenBank Submission: BT032952

> IP20969.complete
AAAGAACCTCCAAGCAATGAGCAACTTCATCATTGGAATCGCAGTAATTT
GCTGTCTGTGGCGTCGCGTGCAAGGATTTCAAATGCTCCTGGAAGAGGAT
TGCGGGATTCCGCATAACATTTCTGAACGAAGTGTAAATGCAAAGTTGGC
GCAGAATCCATGGATGGCCTATTTGGAAACTCCAAAAGGATTCCATTGCT
CTGGCACTCTAATTAATCACTTGTTCGTCTTAACGGCAGCTCACTGTGTT
CCGGACGACTTGCTAATAACCGTTCGCCTGGGAGAGTACAACACGAAGAC
TAAGGTGGACTGTGACAACCACCTGTGCCAGGAACCCTTCCAGGAGTACA
ATGTGGATATGGGCTTCAGGCATAGGTATTATAATGCGAATGACCAAACC
AACGACATCGGCATGCTGCGACTCGGAAGGAGGGTGGAGTACTTAAATCA
CATACGTCCGATTTGCATTTTCGCAAGCAACCGTTTCCAGGAGCCGATAG
ACCAGCTCACCTGGTTTACGACCACCGTTTGGCGTGAAACTGCCGCTAAC
GCAACGAGCAAAGTTCTTCGGACCATGAACATCGACCGCCAACCCAAAGA
GACGTGCTCCGAAATCTATGGCTGGAATATGACGTTCGAACAGATCTGCG
CCGGCAACACCTTGAGTCAACTCTGCAGCACCGACTCCGGGGCTCCGCAG
ATCCGCAAAATGTGGCACAATGGCTCAGACCGCTATGTGCAACTGGGCAT
CGCCAGCAGGGTGAAGGGCCAGTGCCAGAACTCTGGCATTCTCATGGATC
TATTGAGCTACGCTGACTGGATAAAACGGGTGGTACGGCAATACGGACCC
TCGACGGATATGAACCGTTCATTAAAGAAATGGGTCGATAAAATTCCAGT
ATTTTACTACCCGAAATAATATAATATCAATAGTAAGCTTTCATTGCTAG
TCCTTGTTTAATATAATAAATTAAAAAGTTTAATGTTGAACAATAAAGAC
TATGTCGCATTTAACAAAAAAAAAAAAAAAAAA

IP20969.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33462-RA 1056 CG33462-RA 20..1035 1..1016 5080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11584622..11585190 447..1015 2815 99.6 Plus
chr2R 21145070 chr2R 11583984..11584204 1..221 1090 99.5 Plus
chr2R 21145070 chr2R 11584381..11584559 268..446 880 99.4 Plus
chr2R 21145070 chr2R 11584259..11584304 222..267 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15697442..15698011 447..1016 2850 100 Plus
2R 25286936 2R 15696804..15697024 1..221 1105 100 Plus
2R 25286936 2R 15697201..15697379 268..446 895 100 Plus
2R 25286936 2R 15697079..15697124 222..267 230 100 Plus
2R 25286936 2R 15695862..15695996 308..442 195 76.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15698641..15699210 447..1016 2850 100 Plus
2R 25260384 2R 15698003..15698223 1..221 1105 100 Plus
2R 25260384 2R 15698400..15698578 268..446 895 100 Plus
2R 25260384 2R 15698278..15698323 222..267 230 100 Plus
2R 25260384 2R 15697061..15697130 308..377 170 82.8 Plus
Blast to na_te.dros performed 2019-03-15 16:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1156..1239 996..913 131 66.3 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1094..1195 996..888 113 61.5 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1052..1153 987..888 109 57.8 Minus

IP20969.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:39 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11583984..11584204 1..221 99 -> Plus
chr2R 11584259..11584304 222..267 100 -> Plus
chr2R 11584381..11584559 268..446 99 -> Plus
chr2R 11584622..11585190 447..1015 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:22:59 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:57:47 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:17:56 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:56:45 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:04 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:21:52 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:57:46 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..1015 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:17:56 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 11..1025 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:56:45 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 1..903 17..919 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:04 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
CG33462-RA 11..1025 1..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:39 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15696804..15697024 1..221 100 -> Plus
2R 15697079..15697124 222..267 100 -> Plus
2R 15697201..15697379 268..446 100 -> Plus
2R 15697442..15698010 447..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:39 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15696804..15697024 1..221 100 -> Plus
2R 15697079..15697124 222..267 100 -> Plus
2R 15697201..15697379 268..446 100 -> Plus
2R 15697442..15698010 447..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:39 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15696804..15697024 1..221 100 -> Plus
2R 15697079..15697124 222..267 100 -> Plus
2R 15697201..15697379 268..446 100 -> Plus
2R 15697442..15698010 447..1015 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:17:56 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11584309..11584529 1..221 100 -> Plus
arm_2R 11584584..11584629 222..267 100 -> Plus
arm_2R 11584706..11584884 268..446 100 -> Plus
arm_2R 11584947..11585515 447..1015 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:34:01 Download gff for IP20969.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15698003..15698223 1..221 100 -> Plus
2R 15698278..15698323 222..267 100 -> Plus
2R 15698400..15698578 268..446 100 -> Plus
2R 15698641..15699209 447..1015 100   Plus

IP20969.hyp Sequence

Translation from 0 to 918

> IP20969.hyp
KNLQAMSNFIIGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLA
QNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT
KVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH
IRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKE
TCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGI
ASRVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRSLKKWVDKIPV
FYYPK*

IP20969.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33462-PA 300 CG33462-PA 1..300 6..305 1639 100 Plus
CG33461-PB 287 CG33461-PB 26..286 28..282 635 48.3 Plus
CG30090-PA 291 CG30090-PA 11..279 11..280 477 37.6 Plus
CG30286-PB 277 CG30286-PB 22..268 30..274 474 35.6 Plus
CG18636-PA 349 CG18636-PA 24..286 25..282 472 38.3 Plus

IP20969.pep Sequence

Translation from 1 to 918

> IP20969.pep
KNLQAMSNFIIGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLA
QNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT
KVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH
IRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKE
TCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGI
ASRVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRSLKKWVDKIPV
FYYPK*

IP20969.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13370-PA 505 GF13370-PA 9..279 29..280 399 34.6 Plus
Dana\GF11497-PA 284 GF11497-PA 21..277 29..283 392 35.6 Plus
Dana\GF23281-PA 372 GF23281-PA 78..371 12..282 324 30.7 Plus
Dana\GF19774-PA 272 GF19774-PA 3..255 5..278 309 30.5 Plus
Dana\GF18202-PA 393 GF18202-PA 143..392 53..279 296 34.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20771-PA 275 GG20771-PA 11..275 18..281 513 37.2 Plus
Dere\GG20540-PA 291 GG20540-PA 25..279 30..280 473 39.6 Plus
Dere\GG16935-PA 279 GG16935-PA 1..275 6..278 456 37.6 Plus
Dere\GG24240-PA 374 GG24240-PA 4..277 11..279 413 36.1 Plus
Dere\GG16535-PA 281 GG16535-PA 10..276 13..279 411 34.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20292-PA 242 GH20292-PA 4..235 53..274 336 33.2 Plus
Dgri\GH20291-PA 237 GH20291-PA 14..230 64..274 333 34.6 Plus
Dgri\GH23917-PA 235 GH23917-PA 10..228 48..274 310 32.5 Plus
Dgri\GH20624-PA 374 GH20624-PA 120..372 46..282 310 32 Plus
Dgri\GH17524-PA 374 GH17524-PA 120..372 46..282 310 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG33462-PA 300 CG33462-PA 1..300 6..305 1639 100 Plus
CG33461-PB 287 CG33461-PB 26..286 28..282 635 48.3 Plus
CG30090-PA 291 CG30090-PA 11..279 11..280 477 37.6 Plus
CG30286-PB 277 CG30286-PB 22..268 30..274 474 35.6 Plus
CG18636-PA 349 CG18636-PA 24..286 25..282 472 38.3 Plus
CG43336-PA 279 CG43336-PA 17..274 25..277 443 40.2 Plus
CG30082-PB 280 CR30082-PB 3..276 7..279 423 34.8 Plus
CG18420-PA 299 CG18420-PA 1..289 6..301 418 37.7 Plus
CG43335-PA 281 CG43335-PA 6..279 9..281 402 35.1 Plus
CG30087-PA 277 CG30087-PA 9..274 13..278 386 33.2 Plus
CG30083-PB 279 CG30083-PB 2..262 9..281 383 34.9 Plus
CG33458-PA 281 CG33458-PA 20..275 25..278 379 33.9 Plus
CG33459-PA 284 CG33459-PA 20..274 25..276 378 36.8 Plus
CG30088-PB 281 CG30088-PB 4..280 5..282 375 31.1 Plus
CG30091-PA 526 CG30091-PA 17..277 24..278 356 32 Plus
CG4650-PB 299 CG4650-PB 1..275 6..294 331 31.7 Plus
CG30187-PE 489 CG30187-PE 19..266 25..280 323 32.3 Plus
CG30187-PF 500 CG30187-PF 19..266 25..280 323 32.3 Plus
CG30289-PA 316 CG30289-PA 10..292 14..295 320 31.2 Plus
MP1-PA 390 CG1102-PA 140..389 53..279 320 34.4 Plus
MP1-PC 399 CG1102-PC 149..398 53..279 320 34.4 Plus
MP1-PE 400 CG1102-PE 150..399 53..279 320 34.4 Plus
grass-PA 335 CG5896-PA 41..334 12..282 319 29.4 Plus
grass-PB 377 CG5896-PB 83..376 12..282 319 29.4 Plus
CG30288-PC 282 CG30288-PC 8..277 13..281 318 30.7 Plus
CG33226-PC 292 CG33226-PC 29..292 27..284 315 31 Plus
CG43742-PB 474 CG43742-PB 19..277 26..298 308 33.1 Plus
CG30287-PA 284 CG30287-PA 9..278 13..275 304 28.8 Plus
CG33465-PC 488 CG33465-PC 3..273 4..286 303 29.6 Plus
CG30286-PC 152 CG30286-PC 22..141 30..147 299 44.2 Plus
CG30098-PA 264 CG30098-PA 1..255 6..274 299 31.4 Plus
CG30283-PB 273 CG30283-PB 29..269 30..280 290 29.6 Plus
CG10764-PA 523 CG10764-PA 26..264 30..278 289 30.7 Plus
CG43110-PA 483 CG43110-PA 10..259 16..279 279 30 Plus
CG43110-PB 483 CG43110-PB 10..259 16..279 279 30 Plus
CG33225-PB 292 CG33225-PB 21..280 25..280 277 29.4 Plus
CG33225-PC 307 CG33225-PC 36..295 25..280 277 29.4 Plus
CG30002-PB 311 CG30002-PB 38..308 26..281 274 29.7 Plus
CG5909-PA 381 CG5909-PA 111..376 24..274 272 30.2 Plus
CG14227-PB 286 CG14227-PB 21..277 24..274 271 30.5 Plus
CG14088-PB 289 CG14088-PB 45..263 53..289 271 30.4 Plus
CG1773-PA 317 CG1773-PA 38..301 26..274 258 28.8 Plus
CG30414-PC 305 CG30414-PC 7..297 12..281 256 29.3 Plus
CG30414-PB 305 CG30414-PB 7..297 12..281 256 29.3 Plus
Sp7-PF 391 CG3066-PF 128..390 34..279 246 28 Plus
Sp7-PE 391 CG3066-PE 128..390 34..279 246 28 Plus
Sp7-PA 391 CG3066-PA 128..390 34..279 246 28 Plus
ea-PA 392 CG4920-PA 116..390 30..278 244 29.3 Plus
SPE-PA 400 CG16705-PA 140..396 46..276 244 30.4 Plus
ea-PB 261 CG4920-PB 1..259 45..278 243 29.2 Plus
CG33460-PA 275 CG33460-PA 27..253 30..278 240 29.2 Plus
CG30091-PA 526 CG30091-PA 303..525 39..279 153 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23202-PA 376 GI23202-PA 74..375 4..282 315 29.8 Plus
Dmoj\GI22268-PA 380 GI22268-PA 104..379 21..278 307 32.1 Plus
Dmoj\GI10853-PA 285 GI10853-PA 14..284 33..279 279 30.8 Plus
Dmoj\GI24877-PA 392 GI24877-PA 114..391 28..279 272 29.9 Plus
Dmoj\GI24320-PA 447 GI24320-PA 172..447 25..280 270 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11858-PA 345 GL11858-PA 1..285 6..281 591 40.1 Plus
Dper\GL11857-PA 283 GL11857-PA 1..278 6..280 548 39.6 Plus
Dper\GL17488-PA 282 GL17488-PA 1..278 6..279 519 38 Plus
Dper\GL10743-PA 279 GL10743-PA 19..275 26..279 436 36.7 Plus
Dper\GL16656-PA 282 GL16656-PA 40..277 44..280 401 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25145-PA 345 GA25145-PA 1..285 6..281 582 39.7 Plus
Dpse\GA15642-PA 283 GA15642-PA 1..278 6..280 545 39.6 Plus
Dpse\GA24176-PA 282 GA24176-PA 1..278 6..279 512 38 Plus
Dpse\GA24468-PA 278 GA24468-PA 20..274 26..279 446 36.2 Plus
Dpse\GA24685-PA 284 GA24685-PA 15..279 22..280 409 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21635-PA 302 GM21635-PA 1..302 6..305 1398 85.1 Plus
Dsec\GM15715-PA 277 GM15715-PA 21..268 29..274 480 36.7 Plus
Dsec\GM21631-PA 291 GM21631-PA 14..279 14..280 471 37.3 Plus
Dsec\GM14686-PA 346 GM14686-PA 1..286 6..282 471 36.6 Plus
Dsec\GM15960-PA 278 GM15960-PA 4..277 11..281 425 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11137-PA 302 GD11137-PA 1..302 6..305 1384 83.8 Plus
Dsim\GD11133-PA 295 GD11133-PA 14..279 14..280 468 37.3 Plus
Dsim\GD25604-PA 280 GD25604-PA 6..276 10..279 447 34.8 Plus
Dsim\GD19034-PA 256 GD19034-PA 21..251 47..277 444 41.4 Plus
Dsim\GD21987-PA 288 GD21987-PA 1..228 55..282 441 39.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21214-PA 280 GJ21214-PA 4..273 17..274 373 33 Plus
Dvir\GJ21978-PA 296 GJ21978-PA 20..292 17..278 363 32.7 Plus
Dvir\GJ21212-PA 268 GJ21212-PA 3..261 28..274 359 32.4 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 78..363 12..274 314 30.6 Plus
Dvir\GJ24059-PA 397 GJ24059-PA 153..394 47..276 297 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11884-PA 375 GK11884-PA 81..366 12..274 317 31.2 Plus
Dwil\GK10951-PA 391 GK10951-PA 120..390 33..279 283 31.9 Plus
Dwil\GK23933-PA 280 GK23933-PA 19..250 53..274 274 30 Plus
Dwil\GK22647-PA 279 GK22647-PA 41..278 54..279 269 30.6 Plus
Dwil\GK11130-PA 392 GK11130-PA 131..391 44..279 269 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11730-PA 306 GE11730-PA 1..305 6..304 1134 67.9 Plus
Dyak\GE11729-PA 289 GE11729-PA 5..288 6..282 663 47.9 Plus
Dyak\GE11725-PA 296 GE11725-PA 11..276 11..280 481 38 Plus
Dyak\GE13707-PA 275 GE13707-PA 4..275 13..281 473 35.2 Plus
Dyak\GE24322-PA 279 GE24322-PA 10..274 18..277 471 39.1 Plus