Clone IP20981 Report

Search the DGRC for IP20981

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:209
Well:81
Vector:pOT2
Associated Gene/TranscriptCG7130-RA
Protein status:IP20981.pep: gold
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7130 2008-05-05 Release 5.5 slip selected
CG7130 2008-08-15 Release 5.9 accounting
CG7130 2008-12-18 5.12 accounting

Clone Sequence Records

IP20981.complete Sequence

711 bp assembled on 2008-05-22

GenBank Submission: BT032774

> IP20981.complete
CTCGCATTACCACATAAGCACCAACAAGTCGAGACGCTGCCTCACATTCC
ATACACGGCGCAACACCGCTAGACGACCATCTCAGCCAGAACAAGGAGAA
TACCATTTCACCACAATGGGTAAGGATTACTACAAGATTCTGGGCATCGA
GAGGAATGCGTCCAGCGAAGACGTCAAGAAGGGATACCGCCGGATGGCTC
TCCGCTACCATCCGGACAAGAACGACCATCCGCAGGCCGAGGAGCAGTTT
AGGGAGGTGGTGGCCGCCTTCGAAGTGCTCTTTGATAAGGAAAAGCGCGA
GATATACGACCAGCACGGCGAGGAGGGTCTCAAATGTGATGACGAGCCTG
CTGCGACCTTCGCCCAGCCCACGCCAGACATGCTCCCCTTCATGTGCGCC
GTCGGAGGAACCGTGCTCTTTGCGTTCGCCGCCTACAAGACATTCCAGTT
CTTCAACCGGAAAAAAGAGGCTACCCACGGCGATGGATCCTCCTCGGACT
GAGCTAAGGATCCAAGGGCTTGATGAAGCAATCTCGGGTACCTAGCGTTC
TTCGCTGAATAGTCTTTAAGATTAATTTATAGGAACTTAATTATTGACTG
TTTATCTAATGAATCCTGCGTTACTTATTGATTAATTTATTTATTTATTT
AGTAAGATAAATAAAAATTATGGAATTCGTCCGACTGTTGCTCGAAAAAA
AAAAAAAAAAA

IP20981.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG7130-RA 701 CG7130-RA 8..701 1..694 3470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22063991..22064684 694..1 3470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:44:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22075052..22075749 698..1 3490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22068152..22068849 698..1 3490 100 Minus
Blast to na_te.dros performed 2019-03-16 11:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 224..265 628..671 133 84.1 Plus
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4138..4174 665..628 124 84.2 Minus
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4134..4174 671..632 121 80.5 Minus
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4135..4173 664..625 116 80 Minus
Dtei\I-element 5386 Dtei\I-element DTEII 5386bp 5220..5292 692..621 110 63 Minus

IP20981.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:39:07 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22063991..22064684 1..694 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:23:01 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 1..387 116..502 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:37:57 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 1..387 116..502 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:07:05 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 1..387 116..502 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:43 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 1..387 116..502 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:25 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 1..387 116..502 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:08 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 8..701 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:37:56 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 8..701 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:07:05 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 8..701 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:43:43 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 8..701 1..694 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:25 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
CG7130-RA 8..701 1..694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:07 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22075056..22075749 1..694 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:07 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22075056..22075749 1..694 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:07 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22075056..22075749 1..694 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:07:05 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22068156..22068849 1..694 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:44 Download gff for IP20981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22068156..22068849 1..694 100   Minus

IP20981.hyp Sequence

Translation from 0 to 501

> IP20981.hyp
SHYHISTNKSRRCLTFHTRRNTARRPSQPEQGEYHFTTMGKDYYKILGIE
RNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKRE
IYDQHGEEGLKCDDEPAATFAQPTPDMLPFMCAVGGTVLFAFAAYKTFQF
FNRKKEATHGDGSSSD*

IP20981.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7130-PA 128 CG7130-PA 1..128 39..166 684 100 Plus
DnaJ-1-PA 334 CG10578-PA 1..80 39..126 279 58 Plus
DnaJ-1-PB 334 CG10578-PB 1..80 39..126 279 58 Plus
CG5001-PC 346 CG5001-PC 1..109 39..130 266 48.6 Plus
CG5001-PD 350 CG5001-PD 1..109 39..130 266 48.6 Plus

IP20981.pep Sequence

Translation from 1 to 501

> IP20981.pep
SHYHISTNKSRRCLTFHTRRNTARRPSQPEQGEYHFTTMGKDYYKILGIE
RNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKRE
IYDQHGEEGLKCDDEPAATFAQPTPDMLPFMCAVGGTVLFAFAAYKTFQF
FNRKKEATHGDGSSSD*

IP20981.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23490-PA 130 GF23490-PA 1..130 39..166 576 85.4 Plus
Dana\GF19555-PA 334 GF19555-PA 1..78 39..114 278 66.7 Plus
Dana\GF10450-PA 354 GF10450-PA 1..116 39..136 274 49.1 Plus
Dana\GF15175-PA 346 GF15175-PA 1..101 39..122 254 50.5 Plus
Dana\GF10972-PA 250 GF10972-PA 2..86 27..110 201 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13187-PA 127 GG13187-PA 1..127 39..166 620 92.2 Plus
Dere\DnaJ-1-PA 351 GG14117-PA 1..73 39..111 272 63 Plus
Dere\GG24779-PA 350 GG24779-PA 1..101 39..122 254 49.5 Plus
Dere\GG18918-PA 332 GG18918-PA 1..70 39..108 246 61.4 Plus
Dere\GG16248-PA 249 GG16248-PA 2..86 27..110 198 44.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16902-PA 127 GH16902-PA 1..127 39..166 468 68 Plus
Dgri\GH15011-PA 353 GH15011-PA 1..73 39..111 279 64.4 Plus
Dgri\GH11404-PA 346 GH11404-PA 1..74 39..112 260 63.5 Plus
Dgri\GH16687-PA 262 GH16687-PA 11..86 36..110 197 47.4 Plus
Dgri\GH11226-PA 355 GH11226-PA 23..95 40..111 189 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7130-PA 128 CG7130-PA 1..128 39..166 684 100 Plus
DnaJ-1-PA 334 CG10578-PA 1..80 39..126 279 58 Plus
DnaJ-1-PB 334 CG10578-PB 1..80 39..126 279 58 Plus
CG5001-PC 346 CG5001-PC 1..109 39..130 266 48.6 Plus
CG5001-PD 350 CG5001-PD 1..109 39..130 266 48.6 Plus
CG5001-PA 350 CG5001-PA 1..109 39..130 266 48.6 Plus
CG5001-PB 350 CG5001-PB 1..109 39..130 266 48.6 Plus
CG2887-PA 342 CG2887-PA 1..73 39..111 227 56.2 Plus
CG32641-PA 132 CG32641-PA 1..123 39..149 209 36.2 Plus
CG32640-PA 132 CG32640-PA 1..123 39..149 209 36.2 Plus
mrj-PA 259 CG8448-PA 3..73 42..110 204 52.1 Plus
mrj-PC 259 CG8448-PC 3..73 42..110 204 52.1 Plus
mrj-PB 259 CG8448-PB 3..73 42..110 204 52.1 Plus
mrj-PD 259 CG8448-PD 3..73 42..110 204 52.1 Plus
shv-PA 354 CG4164-PA 23..95 40..111 201 52.1 Plus
Droj2-PE 403 CG8863-PE 7..85 43..123 198 44.4 Plus
Droj2-PD 403 CG8863-PD 7..85 43..123 198 44.4 Plus
Droj2-PC 403 CG8863-PC 7..85 43..123 198 44.4 Plus
Droj2-PB 403 CG8863-PB 7..85 43..123 198 44.4 Plus
Droj2-PA 403 CG8863-PA 7..85 43..123 198 44.4 Plus
Csp-PA 223 CG6395-PA 2..86 27..110 196 44.7 Plus
Csp-PC 228 CG6395-PC 2..86 27..110 196 44.7 Plus
Csp-PE 244 CG6395-PE 2..86 27..110 196 44.7 Plus
Csp-PD 244 CG6395-PD 2..86 27..110 196 44.7 Plus
Csp-PF 249 CG6395-PF 2..86 27..110 196 44.7 Plus
Csp-PB 249 CG6395-PB 2..86 27..110 196 44.7 Plus
l(2)tid-PE 445 CG5504-PE 18..131 11..107 190 39.5 Plus
l(2)tid-PA 447 CG5504-PA 18..131 11..107 190 39.5 Plus
l(2)tid-PC 507 CG5504-PC 18..131 11..107 190 39.5 Plus
l(2)tid-PD 514 CG5504-PD 18..131 11..107 190 39.5 Plus
l(2)tid-PB 520 CG5504-PB 18..131 11..107 190 39.5 Plus
mrj-PG 346 CG8448-PG 3..66 42..103 178 53.1 Plus
mrj-PH 346 CG8448-PH 3..66 42..103 178 53.1 Plus
mrj-PE 346 CG8448-PE 3..66 42..103 178 53.1 Plus
Tpr2-PE 464 CG4599-PE 357..444 41..120 175 45.5 Plus
Tpr2-PB 464 CG4599-PB 357..444 41..120 175 45.5 Plus
Tpr2-PC 478 CG4599-PC 371..458 41..120 175 45.5 Plus
Tpr2-PD 508 CG4599-PD 401..488 41..120 175 45.5 Plus
Tpr2-PA 508 CG4599-PA 401..488 41..120 175 45.5 Plus
DnaJ-H-PA 389 CG9828-PA 7..72 44..111 174 47.1 Plus
DnaJ-H-PB 389 CG9828-PB 7..72 44..111 174 47.1 Plus
DnaJ-H-PC 440 CG9828-PC 7..72 44..111 174 47.1 Plus
CG3061-PA 370 CG3061-PA 105..170 41..106 171 47 Plus
CG2790-PA 540 CG2790-PA 4..74 43..111 169 46.5 Plus
CG14650-PA 970 CG14650-PA 687..776 22..110 169 41.1 Plus
P58IPK-PA 498 CG8286-PA 395..466 41..110 158 45.2 Plus
CG7556-PB 522 CG7556-PB 37..149 39..145 153 31 Plus
CG7556-PA 522 CG7556-PA 37..149 39..145 153 31 Plus
CG7133-PA 353 CG7133-PA 6..131 41..149 150 28.1 Plus
jdp-PC 170 CG2239-PC 16..86 41..110 145 40.8 Plus
jdp-PB 182 CG2239-PB 16..86 41..110 145 40.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11521-PA 505 GI11521-PA 1..118 39..157 453 68.1 Plus
Dmoj\GI13174-PA 352 GI13174-PA 1..73 39..111 284 65.8 Plus
Dmoj\GI15199-PA 325 GI15199-PA 1..73 39..111 268 65.8 Plus
Dmoj\GI14539-PA 347 GI14539-PA 1..74 39..112 253 60.8 Plus
Dmoj\GI11373-PA 249 GI11373-PA 10..85 36..110 198 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25452-PA 129 GL25452-PA 1..129 39..166 549 79.1 Plus
Dper\GL20776-PA 230 GL20776-PA 1..117 39..136 270 47.9 Plus
Dper\GL15626-PA 318 GL15626-PA 1..107 39..130 265 50.5 Plus
Dper\GL19053-PA 132 GL19053-PA 1..117 39..152 233 39.3 Plus
Dper\GL20793-PA 158 GL20793-PA 11..118 36..134 197 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20124-PA 291 GA20124-PA 1..88 65..153 432 85.4 Plus
Dpse\GA10408-PA 353 GA10408-PA 1..73 39..111 271 63 Plus
Dpse\GA18584-PA 346 GA18584-PA 1..101 39..122 260 51.5 Plus
Dpse\GA25325-PA 132 GA25325-PA 1..128 39..165 234 38.5 Plus
Dpse\GA19562-PA 250 GA19562-PA 11..86 36..110 196 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22099-PA 128 GM22099-PA 1..128 39..166 655 95.3 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 1..80 39..126 286 59.1 Plus
Dsec\GM16806-PA 350 GM16806-PA 1..101 39..122 260 50.5 Plus
Dsec\GM11309-PA 344 GM11309-PA 1..73 39..111 222 56.2 Plus
Dsec\GM11609-PA 132 GM11609-PA 1..129 39..152 202 36.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12075-PA 128 GD12075-PA 1..128 39..166 649 94.5 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 1..122 39..141 277 48.4 Plus
Dsim\GD23083-PA 346 GD23083-PA 1..109 39..130 260 48.6 Plus
Dsim\GD16032-PA 300 GD16032-PA 1..71 39..109 221 56.3 Plus
Dsim\GD17653-PA 189 GD17653-PA 12..87 36..110 195 48.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11775-PA 124 GJ11775-PA 1..124 39..166 444 67.2 Plus
Dvir\GJ11949-PA 351 GJ11949-PA 1..70 39..108 277 67.1 Plus
Dvir\GJ14805-PA 325 GJ14805-PA 1..73 39..111 263 64.4 Plus
Dvir\GJ16971-PA 347 GJ16971-PA 1..74 39..112 255 60.8 Plus
Dvir\GJ11627-PA 245 GJ11627-PA 11..86 36..110 199 47.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19161-PA 125 GK19161-PA 1..111 39..151 366 60.2 Plus
Dwil\GK16875-PA 356 GK16875-PA 1..86 39..124 277 57 Plus
Dwil\GK19767-PA 330 GK19767-PA 1..73 39..111 266 64.4 Plus
Dwil\GK15183-PA 346 GK15183-PA 1..109 39..130 263 49.5 Plus
Dwil\GK10421-PA 316 GK10421-PA 1..67 39..105 241 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22992-PA 127 GE22992-PA 1..127 39..166 625 92.2 Plus
Dyak\GE19512-PA 127 GE19512-PA 1..127 39..166 625 92.2 Plus
Dyak\DnaJ-1-PA 351 GE20542-PA 1..80 39..126 273 55.7 Plus
Dyak\GE17451-PA 350 GE17451-PA 1..101 39..122 254 49.5 Plus
Dyak\GE22607-PA 249 GE22607-PA 2..86 27..110 198 44.7 Plus